(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE405

MICSR_1.PE405        Location/Qualifiers
FT   CDS_pept        complement(784798..785670)
FT                   /codon_start=1
FT                   /gene_family="HOG000264353" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637035"
FT                   /orf_name="MICPUN_56985"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62224.1"
FT                   /db_xref="HOGENOM:HBG560191"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="UniParc:UPI000199A9F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T2"
FT                   /transl_table=1
FT                   /translation="MSSASTLSARVAHSAGVRAPGGARRSFRATRIVSRAVAEDESSSS
FT                   AVYQPAVAPEQPSGADVNAAAKKRLLAVAAASGRGLDATPAQKTAASSLIAELIAANPN
FT                   PEPATSPTIDGDWELVYSDTFLFRSSPFFWAVGSMMGDTADFFYQAHSHQTGIFGGGVG
FT                   RVVQTVDTKGGRLISDCVVKASVGIPLLGFSPVFAGYGSVITAGRCAAKDGTRLAVTAE
FT                   TTTVRQDDANVLPQLNFLNGTTVPVEDVMKQVGGGEAGPEVYLDTFYLDDEMRISKLED
FT                   GSVFVYQRC"
     atgtcgtccg caagcacgct ctccgcgcgc gtcgcgcatt ccgccggcgt ccgcgccccc        60
     ggcggcgctc gccgctcctt tcgcgcgacg cgaatcgtct ctcgcgccgt cgccgaggac       120
     gagtcatcct cctccgcggt ctaccagccc gccgtggccc ccgagcagcc atccggcgcc       180
     gacgtcaacg cggctgcgaa gaagcgcctg ctcgcggtcg ccgccgcgtc cggccgcggc       240
     ctcgacgcca cccccgcgca gaagaccgcg gcgtcctcgc tcatcgccga gctcatcgcc       300
     gccaacccca acccggaacc cgccacctct cccaccatcg atggcgactg ggagcttgtc       360
     tattccgaca ccttcctctt ccgctcctcc ccgttcttct gggcggtggg cagcatgatg       420
     ggcgacaccg cggacttctt ctaccaggcg cattcgcacc agacgggaat cttcggcggc       480
     ggcgtcgggc gcgtggttca gaccgtggac accaaggggg gtcggctcat cagtgactgc       540
     gtcgtcaagg cgtctgtggg catcccgctg ctgggcttct ccccggtctt cgcgggatac       600
     ggctcggtca tcaccgcggg gcggtgcgcg gcgaaggacg gtacgcggct ggcggtgacc       660
     gccgagacca cgacggtgag acaggacgac gcgaacgtgc tgccgcagct caactttctc       720
     aacgggacca ccgtgccggt ggaggacgtg atgaagcagg ttggcggggg cgaggccggg       780
     cccgaggtgt acctcgacac cttctacctc gacgacgaga tgaggatcag caagctcgag       840
     gacggcagcg tgttcgtcta ccagcgctgc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page