(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE407

MICSR_1.PE407        Location/Qualifiers
FT   CDS_pept        <790154..>790432
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637037"
FT                   /orf_name="MICPUN_76840"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO61795.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199A9FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T4"
FT                   /transl_table=1
FT                   /translation="IRDDGSSTSNVVEFNVVAHLTVGEHLVLVGNVAELGGWKVDVGRR
FT                   MTWSEGDVWKTSISIPNAEASVEFKFVRYNDNNGVLTWQEGDNYACEL"
     atacgcgacg acggttcttc caccagcaac gtcgtcgagt tcaacgtggt ggcgcacctc        60
     accgtcggcg agcacctcgt cctggtgggc aacgtcgccg agctgggcgg atggaaggtg       120
     gacgtcggcc gccgcatgac ctggtccgag ggcgacgtct ggaagaccag catctccatc       180
     cccaacgccg aggcgagcgt cgagttcaag tttgtccgct acaacgacaa caacggcgtg       240
     ctgacctggc aggagggaga caactacgcc tgcgagctc                              279
//

If you have problems or comments...

PBIL Back to PBIL home page