(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE409

MICSR_1.PE409        Location/Qualifiers
FT   CDS_pept        join(797905..797997,798118..798206,798333..799170)
FT                   /codon_start=1
FT                   /gene_family="HOG000214351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637039"
FT                   /orf_name="MICPUN_56989"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61796.1"
FT                   /db_xref="HOGENOM:HBG676888"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A9FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T6"
FT                   /transl_table=1
FT                   /translation="MASRRLLRAASAGDIDAVDALIREGADPGFQDRKGTTPLMLACEH
FT                   GHVDVVRSLLAAGAPWNELDNEGHCAGEYASAGGHAELTDALIDHAVSAEMVLGAVSRA
FT                   RPREADLTYLSQPVRYDGDDKLLDTENDAVMMDWEAPLMRIHAQVMCAGKGDTLNVGFG
FT                   MGIIDGYVVNENETRSHTIIEAHPDVHAHMLRRGWDAKRGVRVEFGRWQEVLDRIIREN
FT                   ESLPDGEKRLFDGVNFDTYGEDYDDLREFHALLPKIMRPGGVYTYFNGLAPDNIFFHTV
FT                   YCRLAQAELASLGFDTKFDVVDIDTRDPEIWRGVKRRYWWGDKYFLPTCTLTGAAGSE"
     atggcgtcgc gtcgacttct ccgagcagcc tcggccggcg acatcgacgc agtcgatgcg        60
     ttgatccgcg agggcgcgga ccctggattc caggaccgca aggggacgac gcctttgatg       120
     ctggcgtgtg agcacggaca tgtggacgtc gtccgcagcc ttctcgccgc gggagcaccg       180
     tggaacgagc tggacaacga ggggcactgc gcgggagagt acgccagcgc gggaggccac       240
     gccgagctca ccgacgcgct catcgaccac gcggtgagcg cggagatggt gctcggcgcc       300
     gtcagccgcg ctcgcccccg ggaggccgac ctgacgtacc tatcccaacc cgtgcggtac       360
     gacggggacg ataagctgct ggacaccgag aacgacgcgg tgatgatgga ctgggaggcg       420
     cccttgatgc gaatccacgc ccaggtcatg tgcgcgggta agggggacac gctcaacgtc       480
     gggtttggca tgggcatcat cgacgggtac gtggtgaacg agaacgagac gcgatcgcac       540
     accatcatag aggcgcaccc ggacgttcac gcgcacatgc tccggcgtgg gtgggacgcg       600
     aagagagggg tgcgcgtgga gttcggccgg tggcaggagg tgttggacag gataatcagg       660
     gagaacgagt cgctgccgga tggcgagaag cgactcttcg acggcgtcaa ctttgacacg       720
     tacggggagg actacgacga cctgcgagag ttccacgcgc tcctcccgaa gatcatgcgt       780
     ccgggcggtg tgtacacgta ctttaacggc ctggccccgg acaacatctt cttccacacg       840
     gtgtactgca ggctggcgca ggcggagctc gcgagcttgg gtttcgacac caagtttgac       900
     gtcgtcgaca ttgacacgag ggacccggag atttggcgcg gggtgaagcg gcggtactgg       960
     tggggagaca agtacttcct ccccacctgt accctcacgg gcgcggcggg cagtgagtga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page