(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE41

MICSR_1.PE41         Location/Qualifiers
FT   CDS_pept        join(81190..81219,81391..81435,81611..82810)
FT                   /codon_start=1
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636046"
FT                   /orf_name="MICPUN_97107"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="adenylosuccinate synthase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61604.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004019"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="HOGENOM:HBG658237"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="UniParc:UPI000199AB30"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R8"
FT                   /transl_table=1
FT                   /translation="MSAVALSSAAWGDEGKGKLVDILAQEYDIVARCQGGANAGHTIYD
FT                   DEGKKYALHLVPSGILNEKAKCVVGNGVVVHLPGMFNEIDTLEKAGVKIDASRLVISDR
FT                   AHMLFDLHKEIDGLREAELSGNKIGTTKRGIGPAYASKATRNGIRVGDIRNPETFAQKL
FT                   RTLAADAAARFEDFEYDVEAELVAYQKYAERITPFIADTVHMINEEHKAGKRVLVEGAN
FT                   ATMLDLDFGTYPFVTSSNPSLGGVCSGLGLAPNKFETVIGVAKAYTTRVGAGPYPTELF
FT                   GELADDLREKGYEYGTTTGRPRRIGWLDVVALNYASAINGFTHLNLTKLDVLSGLPELK
FT                   IATAYKLGDGTVTNAFPSSIEELEKVECVYETLPGWEEDISKMRDWDELPAKCKAYVEK
FT                   IEELTGVECRYLGVGPGRDAIVVKP"
     atgagcgccg tcgcactctc gtccgccgcc tggggagacg agggcaaggg gaagctcgtc        60
     gacatcctcg cccaggagta cgacatcgtc gcgaggtgcc agggcggcgc caacgcgggc       120
     cacaccatct acgacgacga gggcaaaaag tacgcgctcc atctcgtgcc ctccggcatc       180
     ctcaacgaga aggccaagtg cgtcgtgggc aacggcgtgg tggtccacct ccccggtatg       240
     ttcaacgaga tcgataccct cgagaaggcg ggggtgaaga tcgacgcatc tcgcctggtc       300
     atctccgacc gcgcgcacat gctcttcgac ctccacaagg agattgacgg cttgcgcgaa       360
     gccgagctct ccggtaacaa gattggcacc accaagcgcg gcatcggccc ggcctacgcg       420
     tccaaggcga cccgcaacgg catccgcgtc ggggacattc ggaaccccga gacgttcgcg       480
     cagaagctca ggacgctcgc cgccgacgcc gccgcgaggt ttgaagattt cgagtacgac       540
     gtcgaggcgg agctcgtcgc gtaccagaag tacgccgagc gcatcacccc gttcatcgcc       600
     gacaccgtgc acatgatcaa cgaggagcac aaggcgggca agcgggtgct cgtcgagggc       660
     gccaacgcca ccatgctcga cctcgatttc ggcacctacc ccttcgtcac ctcgtccaac       720
     ccgtcgctcg gcggcgtgtg cagcggcctc gggttagcgc ccaacaagtt cgagacggtc       780
     atcggcgtcg ccaaggcgta cacgacgcgc gtcggcgcgg gaccgtatcc caccgagctc       840
     ttcggcgagc tcgcggacga cctccgcgag aaggggtacg agtacggcac caccaccggc       900
     cgccccaggc gcatcggctg gctcgacgtc gtcgcgctca actacgcgtc cgccatcaac       960
     gggttcacgc acctcaacct caccaagctc gacgtgctct ccggcctgcc cgagctcaag      1020
     atcgccaccg cgtacaagct cggcgacggc accgtcacga acgccttccc ctcgtccatc      1080
     gaggagctcg aaaaggttga gtgcgtgtac gagacgttgc ccggatggga ggaggacatc      1140
     tccaagatgc gcgactggga cgagctcccg gcgaaatgca aggcgtacgt ggagaagatc      1200
     gaggagctca ccggcgtgga gtgcaggtac ctcggcgtcg ggcccgggcg cgacgcgatc      1260
     gtcgtcaagc cttga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page