(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE410

MICSR_1.PE410        Location/Qualifiers
FT   CDS_pept        join(799328..801076,801114..802796)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637040"
FT                   /orf_name="MICPUN_56990"
FT                   /product="Predicted protein"
FT                   /function="RNA methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO61797.1"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A9FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T7"
FT                   /transl_table=1
FT                   /translation="MEDPGAPDWSRCRRVAAIHAHSASVKCVSGGRWPAGHPGESGRMR
FT                   GDDSRTTVDGFATAGLDGAARVWTLDGTSSSGFRCVAAFGDHTAGVRAVAMPPPRGTGR
FT                   DRASSSSSSSSGIPRTAPEMLAATGSYDRTARLWHASRAVPPVPPLANGHSDYVLCVSF
FT                   GPDARTLVTGGADGRICVWDCDDAAAGNPAPAACLRPGSNAAVRSVDASLPPPSEDEPG
FT                   DVLSMTGGEDGTLRVFSHASGGGAVCEVVFAGHGGAVTSLALCRGEERGWGSPPRARKE
FT                   NVPGTRRIRIAAGHDGGVLSVHDAALTSEAGGDENARASVKVKVREAFVGRVHANGAAR
FT                   ATLLLRPDARIVASASEDRTVRLWNMQKGNCLSVLVGARCTVESVSFSALGDLLYAGLA
FT                   DGHVWVYLEESGEEEDDACAGGGIERRVIESRLALAMEALRDPKDPRASSASESERCAS
FT                   GAAPSARRFQDAYEEMECDALGLLPRVDRSNVALVGEVAGGSLGGGGFAWSERGNPTLS
FT                   CSVCRGELELGFEDPGGDWPAPLPCGHVFHARSCLVPWLRHSPACPLCRANALGSGEPP
FT                   PAACLPVEPKRSCWSSLRARGSREVAGYSGFVPIESSTMTGDASSTAAEGARGEPVPGG
FT                   EPAAQEEIPEYHDPVDASTYSAALDAKVAELERLFSPLMQQASIPILNAKGVDRSVSVR
FT                   PEVFPSPPLNFRSRCRFQVMWEDAPVTAESTGITPGESVEPGRRLSYRMWNKGKPTVPI
FT                   TEFPMALREIEELMPAVLREAEAHPELGDGLQAIHFLASRGIRGGMLVTMVYGRPIDEA
FT                   WKMAAEGPRARLKAAMVDIRERVYGGGDDDGFDGFAGPRGDDEELDATALNILGRSRGT
FT                   QIVVGDACHVFETLALRDGRRLRYRQAEGAFSNPNSFMAESTLDWLCDCAATTVREALG
FT                   GTSEHSAEAAPPSLLELYSGNGNHTVALAKYFDSVAAVELSGVLCEAARENLERNGVEN
FT                   AKVLHSPSESVARGMLRRKKRHEEGRVGKAAMAAAATGAGDGSKRGDGSGMEFDINAYD
FT                   VVLVDPPRAGLDPDTLDLVSRFDVVLYISCDPRKGLLENAVGPHAARALDTGEFEGEFK
FT                   GWSGLARTHDLVRFAVFDHFPYTRHIECGACFVRRR"
     atggaggacc ccggcgcccc cgattggtcc cggtgccgtc gcgtcgcggc aatacacgcg        60
     cacagcgcga gtgttaagtg cgtctccggt ggacgatggc ccgcggggca tcccggcgag       120
     tccggacgca tgaggggcga cgactcgagg acgaccgtgg acgggttcgc gaccgcgggg       180
     ttggacggcg cggcgcgcgt atggaccctg gacggcacga gctccagcgg attcaggtgc       240
     gtcgccgcat tcggcgatca caccgccggg gtgcgcgcgg tcgccatgcc gcccccgcgc       300
     ggcacgggac gcgaccgagc gtcgtcgtcc tcgtcctcgt cgtccgggat cccgcgaacg       360
     gcacccgaga tgctcgccgc gacgggatcc tacgaccgca ccgcgaggct gtggcacgca       420
     tcgcgagccg tgccccccgt cccccccctc gcgaacggac acagcgacta cgtcctgtgc       480
     gtgtccttcg gccccgacgc ccgcacgctg gtcacgggag gcgccgacgg gcggatatgc       540
     gtctgggatt gcgacgacgc cgccgccggg aaccccgccc ccgcggcgtg tcttcgcccc       600
     gggagcaacg ccgcggttcg atccgtcgac gcgtcgttac ccccgccgtc ggaggacgaa       660
     cccggcgacg tgctgtccat gacggggggt gaggacggga ccctgcgggt gttctcgcac       720
     gcgtccggcg gcggagcggt ttgcgaagtc gtctttgccg gtcacggcgg cgcggtgacc       780
     tccttggcgc tgtgccgcgg cgaggaacgg ggatggggct caccgccgcg ggcgcggaag       840
     gagaacgtgc ccgggacgcg tcgtatccgg atcgccgcgg ggcacgacgg gggcgtcctg       900
     tcggtgcacg acgcggcgtt gacctccgag gcgggggggg acgaaaacgc tcgggcgtcg       960
     gtgaaggtga aggttcgcga ggcgtttgtc ggtcgggtgc acgcgaacgg cgccgcgcgc      1020
     gcgactctgc tgctccgccc cgacgcccgg atcgtcgcga gcgcgtccga ggatcggacc      1080
     gtgcgcctgt ggaacatgca gaagggtaat tgcctctccg tgttggtcgg cgcgaggtgt      1140
     accgtcgagt ccgtgtcctt ctcggcgctg ggcgacttgc tctacgccgg cctcgcggat      1200
     ggccacgtgt gggtgtacct cgaagagagc ggagaggagg aggacgacgc gtgcgcgggt      1260
     ggtggcatcg agcggcgcgt gatcgagtcg cggctggcgt tggccatgga agccctgcga      1320
     gacccaaagg acccgcgagc gtcgtcggcg tcggagtcgg agcggtgcgc gagcggtgcc      1380
     gcgccgtcgg ctcggcggtt ccaggatgcg tacgaggaga tggagtgcga cgcgctcggg      1440
     ctgttaccca gggtggaccg ttcgaacgta gcgctggtgg gtgaggtggc cggggggtct      1500
     ttaggtggcg gggggttcgc gtggagcgag cgtggtaacc ccacgctgtc gtgttcggtg      1560
     tgccgggggg agttggagtt ggggtttgag gacccgggtg gggattggcc ggcgccgctg      1620
     ccgtgcgggc acgtgtttca cgcgcggtcg tgtctggtgc cgtggttgag gcacagccct      1680
     gcgtgtccgc tgtgccgggc gaacgcgttg gggtcgggtg agcctccgcc ggcggcgtgc      1740
     ctcccggtgg aaccaaaaag atcgtgttgg agttcacttc gcgcgcgggg ctcgcgagag      1800
     gtcgccggat actcggggtt cgtcccgatc gagtcttcga cgatgaccgg ggatgcatcc      1860
     tcgacggccg cggagggcgc acggggcgaa cccgtcccgg gaggcgagcc cgccgcgcag      1920
     gaagagattc cagaatacca cgacccggtc gacgcgtcca cgtactctgc tgcgctggac      1980
     gcgaaggtgg ccgagctcga gcggctcttc tccccgctca tgcagcaggc ctctatcccg      2040
     atcttgaacg ccaaaggggt cgaccggagc gtctcggtcc gtcccgaggt gttcccctcc      2100
     ccgcccctca acttccgatc gcggtgtcga ttccaggtga tgtgggagga cgccccggtg      2160
     accgccgagt ccacggggat cacccccggg gagagcgtgg agccggggcg aaggctgagc      2220
     tatcgcatgt ggaacaaggg taagcccacg gttcccatca ccgagttccc catggcgctg      2280
     agggagatcg aggagctcat gccggcggtg ctcagggagg cggaggcgca tcccgagctc      2340
     ggcgacgggc tgcaggcgat tcacttcctg gcgtccaggg gtatccgcgg agggatgctg      2400
     gtgaccatgg tatacggcag accgatcgat gaggcgtgga agatggcggc ggaggggccc      2460
     cgcgcgaggc taaaggccgc gatggtggac atccgcgaaa gggtctacgg cgggggtgac      2520
     gacgacggct tcgacggctt cgccgggccc cggggcgacg acgaggagtt agacgcgacc      2580
     gctttgaaca tcctcggtcg aagcaggggg acccaaatcg tggtagggga cgcgtgccac      2640
     gtgttcgaga cgctcgcgct ccgcgacggg cggaggctgc ggtacaggca ggcggaaggg      2700
     gcgttcagca acccgaattc gttcatggcg gagtcgaccc tcgactggct ctgcgactgc      2760
     gccgcgacca ccgtccggga agcactcggg ggtacgagcg aacactccgc cgaggccgcc      2820
     cccccgagcc tgctcgagct gtacagcgga aacggaaatc ataccgtggc gctggccaaa      2880
     tatttcgaca gcgtcgccgc ggttgagctc agcggcgtgc tgtgcgaagc cgcgcgggag      2940
     aacctggaga ggaacggggt ggaaaacgcc aaggtgctgc actcgccgag tgaatccgtg      3000
     gcgaggggca tgctcaggcg aaagaagaga cacgaggaag gccgcgtcgg gaaggcggcc      3060
     atggcggcgg cggcaaccgg ggctggagac gggtcaaagc gcggggacgg atccggaatg      3120
     gaatttgaca taaacgcgta cgacgtcgtg ctggtggacc cgccgagggc gggactggac      3180
     ccggacacct tggacctcgt ctcccgcttc gacgtcgtcc tgtacataag ctgcgatcct      3240
     cgtaaggggc tcctcgaaaa cgcggttggc ccccacgcgg ctcgggcgct ggacactggg      3300
     gagtttgaag gggagttcaa ggggtggagc gggctggcca ggacgcacga cctggtgcga      3360
     tttgctgttt tcgaccactt cccgtacacg cgacacatag agtgcggtgc gtgctttgtg      3420
     aggcggcggt ga                                                          3432
//

If you have problems or comments...

PBIL Back to PBIL home page