(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE412

MICSR_1.PE412        Location/Qualifiers
FT   CDS_pept        join(complement(807920..>808056),
FT                   complement(<807347..807859))
FT                   /codon_start=1
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637042"
FT                   /orf_name="MICPUN_71484"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="catalytic activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="ACO62227.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="HOGENOM:HBG464473"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI000199A9FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T9"
FT                   /transl_table=1
FT                   /translation="SPFPNLARPTVDECWAARDALAKLHSSFFQQFETQQAAGGDAIGP
FT                   GKTVLDSLVGTILSQNTTDTNSHRAFAILKHRFPTWEQVRTAKPAKVEDAIRCGGLAEV
FT                   KVSRIQVILNTLKEERGECSMEYLRDMSDDDVKAELSRFKGVGPKTVSCVLMFCLKRPD
FT                   FPVDTHVWKIAKDLGWIPKGAGREDAYEHLNRRVPDDCKFDLHVLLVEHGKVY"
     agccctttcc ccaacctcgc gaggcccacg gtggatgagt gctgggccgc gagggacgcg        60
     cttgcgaagc tccacagctc cttcttccag cagttcgaga cccagcaggc ggcaggcggt       120
     gatgcaatcg gcccggggaa gaccgtactc gactcgttgg tgggcacgat cctctcgcag       180
     aacaccacgg atactaactc ccaccgcgca ttcgccatcc tcaagcaccg gtttccaacc       240
     tgggagcaag tccgaaccgc gaagccggcg aaggttgagg acgccatcag atgcggcggc       300
     ctcgcggagg tcaaggtgag ccgcatccag gtgatactca acacgctgaa ggaggaacgc       360
     ggcgagtgct ccatggagta cctccgagac atgtccgacg acgacgttaa ggccgagctc       420
     agccggttca agggcgttgg ccccaagacg gtgtcgtgcg tgctgatgtt ctgcttgaag       480
     cgcccagact ttcccgtgga cacgcacgtg tggaaaattg caaaggacct cgggtggatt       540
     cccaagggcg ccggtcgcga ggatgcgtac gagcacctca accgaagggt ccccgacgac       600
     tgcaagttcg acctccacgt gctcctggta gagcacggca aggtgtatag                  650
//

If you have problems or comments...

PBIL Back to PBIL home page