(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE413

MICSR_1.PE413        Location/Qualifiers
FT   CDS_pept        join(808814..808970,809076..812455)
FT                   /codon_start=1
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637043"
FT                   /orf_name="MICPUN_93697"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /protein_id="ACO61798.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="HOGENOM:HBG317648"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniParc:UPI000199AA62"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U0"
FT                   /transl_table=1
FT                   /translation="MSEENVAVEEEEEIGQEDAWTVISSFFEEKGLARQQLDSFNEFIQ
FT                   HTMQEIVDEMSDFTIEPEEQHMPGEEADGKGKKKYKVEFKQIYLSKPMVTEADGMTSTL
FT                   FPKEARLRNLTYSAPLYIDMAKSTITTTDEIDATTGKYIETIDTEEYPKVFFGKVPIML
FT                   RSQYCSLHDHTDKELTELGECPYDEGGYFIINGSEKVLIAQEKMSTNHVYVFEKRQPSK
FT                   YMWVAECRSSPESGARAASSCMARLCHAPGTKDEAGVISVTIPYIRTEIPLFVVFRALG
FT                   FVADKDILEHLVYDFEDHEMMQLLRNSIEEAQVIQSQDVALDFIGKRGSAVGVTRPKRI
FT                   QYAREILQKELLPHVGVNEGCETKKAYFLGYIVNRLLLCALGRKKEDDRDHFGNKRMDL
FT                   SGPLIAMLFRQLFRKVTKDVRLYSQRCIDSGKDIQLTLAVKAKTITSGLKYSLATGNWG
FT                   AQGAQDIRAGVSQVLNRLSFSSTLSHLRRLNSPIGREGKLAKPRQLHNSHWGMVCPAET
FT                   PEGQAVGLVKNLSLMCLVSVGSPSAPLLEFLEEWSMENLEEISPSVIVNATKIFVNGVW
FT                   VGVHREPAQLVQTLRNLRRKLDITIEVGVVHDIALRELRLYTDYGRCIRPLFIVEDNHL
FT                   VIKKKDIQMLYEKEITGYTWNDLVATGCIEYVDTEEEETTMIAMTIDELVGQRINAEPG
FT                   GVKHMYTHCEIHPSMILGICASIIPFPDHNQSPRNTYQSAMGKQAMGMYVTNFQIRMDT
FT                   LAYVLFYPQKPLVTTRAMEHLHFRELPAGVNVVVGIMCYTGYNQEDSVIMNQSSIDRGL
FT                   FRSIFYRSFKDEEKKQGSLTKEELERPSRDTTLGMRHGTYDKLDDDGLICPGTRVSGED
FT                   IIIGKTSPLPEDDPSAVSKRFTKRDCSTGMKNSETGIIDQVLLTTNDQGLRFVKIRVRS
FT                   CRTPQVGDKFSSRHGQKGTIGMTYTQEDMPFTCEGIVPDIIVNPHAIPSRMTIGQLVEC
FT                   LMGKVAAMMGKEGDATPFTPVTVESISDMLHMCGYQKRGNEVMYNGHTGRKLEAKIFLG
FT                   PTYYQRLKHMVDDKIHSRGRGPVQILTRQPMEGRSRDGGLRFGEMERDCIISHGAAAFL
FT                   KERLMDQSDAYRIHVCETCGLIAVANLKNQTFECCKNPSERTKVVQVMMPYACKLLFQE
FT                   LMSMAVAPRLVT"
     atgagcgagg agaacgtggc ggtggaggag gaggaagaga tcgggcagga ggatgcttgg        60
     accgtcattt cctctttctt cgaggaaaag ggtctggcgc ggcagcagct cgactcgttc       120
     aacgagttca tccagcacac catgcaggag atcgtcgacg agatgtcaga tttcacgatc       180
     gagccggagg agcagcatat gccgggggag gaagcggatg ggaaggggaa gaagaagtac       240
     aaggtcgagt ttaagcagat ctacctgtcg aagcccatgg tgacggaggc agacggaatg       300
     acctccacgc tcttccccaa ggaggcaagg cttcgcaacc tgacctactc cgcgccgctg       360
     tacatcgaca tggccaagtc caccatcacc acgacggatg agatcgacgc gacgacgggc       420
     aagtatatcg agacgatcga cacggaggag taccccaagg tgttctttgg caaggtgccc       480
     atcatgctgc ggtcgcagta ctgctcgctc cacgaccaca cggacaagga gctcaccgag       540
     cttggcgagt gcccgtacga cgagggcggc tacttcatca tcaacggatc ggagaaggtg       600
     ctcatcgcgc aggagaagat gagcaccaac cacgtctacg tcttcgagaa gaggcagccc       660
     tccaagtaca tgtgggtcgc ggagtgcaga tcctctccgg agagcggcgc gagggcggcg       720
     agctcgtgca tggccaggct ctgccacgcg ccgggaacca aggacgaggc gggtgttatc       780
     agcgtcacca tcccttacat ccgaacggag attcccctct tcgtggtgtt cagggcgctt       840
     ggattcgtcg cggacaagga catcctggaa cacctcgtct acgactttga ggatcacgag       900
     atgatgcagc tgctccgcaa ctccatcgag gaggcgcagg tgatccagtc gcaggacgtg       960
     gcgctagatt tcatcggtaa gcgcgggagc gcggtgggtg tgacgaggcc caaacgcatc      1020
     cagtacgcca gggagattct ccagaaggag ctcctccccc acgtcggcgt caacgagggt      1080
     tgcgagacaa agaaggctta ctttttgggt tacatcgtga acaggctgct gctgtgcgcg      1140
     ctcggtcgca agaaggagga tgaccgcgat cacttcggca acaaacggat ggacctctcc      1200
     ggtcccctca tcgccatgct tttccgccag cttttccgta aggttaccaa ggacgtcagg      1260
     ctgtacagcc aacggtgcat tgactcgggg aaggacatcc agctcacttt ggcggtcaag      1320
     gccaagacga tcacctcggg tctgaaatac tcgctcgcga cgggcaactg gggcgcgcag      1380
     ggtgcgcaag atatccgggc gggcgtctcg caggtgctca accgcttatc gttttcgtct      1440
     acgctgagcc accttcgaag gctgaactcc cctatcggcc gcgagggcaa actcgccaag      1500
     ccgaggcagc tgcacaacag ccactggggc atggtgtgcc ccgcggagac acccgaagga      1560
     caggcggtcg ggctggtgaa aaacctctcc ctcatgtgcc tcgtctctgt tggctcgccc      1620
     agcgccccgc tgctcgaatt tttagaggag tggtcgatgg aaaacctgga ggagatttcg      1680
     ccgtcagtca tcgtcaacgc tacgaagatc ttcgtcaacg gcgtatgggt cggtgtacac      1740
     agggagccgg ctcagctcgt gcagaccctg cgcaacctca ggcgcaagct cgacatcacc      1800
     atcgaggttg gcgttgtcca tgatattgca ctgcgggagc ttcgactgta cacggattat      1860
     gggaggtgca tcaggccgct gttcatcgtc gaagacaacc atctggtgat aaagaagaag      1920
     gacatccaga tgctctacga gaaggaaatc acgggttaca cctggaacga cctcgtggcg      1980
     accgggtgca tcgagtacgt ggacactgag gaggaggaga cgacaatgat tgcgatgaca      2040
     atcgacgagc tcgttgggca gcgcatcaat gcagaacctg ggggcgtcaa acacatgtac      2100
     acccactgcg agatccaccc ctccatgatc ctcggcatct gcgcctcgat cattcccttc      2160
     ccggaccaca atcagtcccc gcgtaacact taccagagtg cgatgggtaa gcaggccatg      2220
     ggcatgtacg tgaccaactt tcagattcgc atggacacgc tggcatacgt ccttttctac      2280
     ccgcagaagc cgctggtgac cacccgcgcg atggagcacc tgcacttccg cgagttgccc      2340
     gcgggcgtca acgtcgtcgt tggcatcatg tgctacacgg gttacaacca ggaggacagc      2400
     gtgatcatga accagtcgtc cattgaccgc gggctcttcc gctcgatttt ttaccggtct      2460
     ttcaaagatg aggagaagaa gcagggctcg ctcacgaagg aggagctcga gaggccgagc      2520
     agagacacca cgctaggtat gcgtcacgga acatacgaca agctcgacga cgacggtttg      2580
     atctgccctg gcacccgagt cagtggtgag gatatcatca tcgggaagac gagcccactc      2640
     cccgaggatg acccgtctgc ggtttccaag cgcttcacca agcgtgactg ctccacggga      2700
     atgaaaaact ccgagaccgg catcatcgac caggtgcttt tgaccacaaa cgaccagggc      2760
     cttaggttcg tcaagattcg cgtgcgatcg tgccgaaccc cccaggttgg cgataagttc      2820
     tcgtccaggc acgggcaaaa gggtacgatt ggcatgactt acacccagga ggatatgccg      2880
     ttcacgtgcg agggtatcgt gccggacatc atcgtcaatc cccacgccat cccctcgcgc      2940
     atgaccatcg ggcagctcgt cgagtgtctc atgggcaagg ttgcggcgat gatgggcaag      3000
     gagggcgacg ccaccccgtt cactcccgtc accgtggaga gcatctctga catgctgcac      3060
     atgtgtggct atcagaagag aggcaacgag gtgatgtaca acggccacac cggacgcaag      3120
     ctcgaagcta agatcttcct cgggcccacg tactaccaga ggctcaagca catggtggac      3180
     gataagatcc actctcgcgg ccgcggcccg gtgcagatcc tcacccgcca gcccatggag      3240
     gggagatcga gggacggtgg cttgcgcttc ggagagatgg agcgcgattg catcatctcg      3300
     cacggcgctg cggcgttcct gaaggagcgc ctcatggatc agtccgacgc ctaccgcatc      3360
     cacgtgtgcg agacgtgcgg cctcatcgcg gtggccaacc tcaagaacca gacgtttgag      3420
     tgctgcaaga acccgagcga gcggaccaag gttgtgcagg tgatgatgcc ctacgcgtgc      3480
     aagctcctct tccaggagct catgtccatg gctgtcgcgc ccaggctggt gacctaa         3537
//

If you have problems or comments...

PBIL Back to PBIL home page