(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE414

MICSR_1.PE414        Location/Qualifiers
FT   CDS_pept        join(<812765..813451,813545..>814126)
FT                   /codon_start=1
FT                   /gene_family="HOG000015126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637044"
FT                   /orf_name="MICPUN_67496"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61799.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG143928"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199AA63"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U1"
FT                   /transl_table=1
FT                   /translation="ILLIWAPAIFYRERVAFNLAGASCQWPAVDEGNGARSSDPSVHVA
FT                   VVADPQLTTYLSYRELGRGNPGLIAVEGISDAYMSRAFRRAVLSNDPEHVLFLGDLIDQ
FT                   GEWIVNPEEWDQARGRFDRIFRWPRRAWSGDVHATGPLDDGDDGVPRDRERPVSYRTVH
FT                   GNHDVGYSRHAVRLRHLHARHEEYFGSTNFVRRLGGVDLVGVGAMALDGADDPGARSAQ
FT                   TNETWAFARRCVGEPARPRVLVTHVPLSKRSYEPGTCGDQRTSEVIRDKTHMSSTAGGR
FT                   RIEIPRHDGLGCYYQDYLRPATSRRLLDKVRPTLVLSGHDHDQCVGTHEVFASDATGRA
FT                   CATSGRSATEHTVGSFSFLMGNPRPSFAMMTVRGACGMDDGACPAELGTGGARDAVNVS
FT                   LCFLPSQWSTFKVYGALGVITVFA"
     atcctcctga tctgggcgcc cgcgatcttt taccgcgagc gtgtggcgtt caacctcgcg        60
     ggggcatcgt gccagtggcc tgcggtggac gaaggaaacg gagcccggag cagtgatcct       120
     tcagtccacg tcgccgtcgt cgcggacccg cagctcacca cgtatctctc ctaccgcgag       180
     cttgggcggg gcaacccggg gctcatcgcg gtcgagggca tctcagacgc gtacatgtcc       240
     cgcgcgttcc gccgcgcggt gctctcgaac gacccggagc acgtgctttt cctgggagat       300
     ctgatcgatc agggcgagtg gatcgtgaac ccggaggagt gggaccaggc ccggggacgg       360
     ttcgaccgca tcttcaggtg gcccaggcga gcgtggagtg gagatgtcca cgcgaccggt       420
     ccgctcgacg acggcgacga cggcgtgccc cgggaccgcg aacggccggt gtcgtatcgc       480
     accgtgcacg ggaaccacga cgtcgggtac tcgcgccacg cggtgcggct ccggcatcta       540
     cacgcgcgac acgaggagta cttcgggtcg acgaactttg tgcggcgttt ggggggagtg       600
     gacctggtgg gggtgggcgc catggcgctc gacggcgcgg atgatcccgg ggcgaggtct       660
     gcgcagacga acgagacgtg ggcgttcgcg cggcgatgcg tcggcgagcc ggctcgcccg       720
     agggtgctgg tgacgcacgt tcctctgtcc aagcggtcgt acgagccggg gacgtgcggg       780
     gaccaacgaa cgtcggaggt gatccgcgat aagacgcaca tgagctcgac ggcgggagga       840
     cgcagaattg agattccgag gcacgacggg ctcgggtgtt actatcagga ttaccttcgc       900
     ccggcgactt cccgtcggct gctcgacaag gtcaggccga cgctggtgct ctccgggcac       960
     gaccacgacc agtgcgtggg cacgcacgag gtgttcgcgt cggatgccac ggggcgcgcg      1020
     tgcgcaacct ccggtcggtc ggcgacagag cacaccgtcg ggtccttttc gttcctgatg      1080
     ggcaacccga ggccgagttt cgcgatgatg acggttcgag gcgcgtgcgg gatggacgac      1140
     ggcgcgtgcc cggcggagct agggaccggc ggagctcgcg acgccgtgaa cgtgtcgctg      1200
     tgcttcctgc cctcgcagtg gagcacgttt aaggtgtacg gcgccctcgg agtcatcacc      1260
     gtcttcgcc                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page