(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE415

MICSR_1.PE415        Location/Qualifiers
FT   CDS_pept        complement(814356..815450)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637045"
FT                   /orf_name="MICPUN_56996"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62228.1"
FT                   /db_xref="UniParc:UPI000199AA64"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U2"
FT                   /transl_table=1
FT                   /translation="MFKREEPETERLLASNPRQKLTVHRGQLYFNDPRVAGAAAPASSS
FT                   GQSHSARIAEKYGGRRYFGGGFSDNTLVDLNQSSSEGDVTSGTEYSDYDYVTDERAQQM
FT                   ERGMRGASVPAGIQTRTAVSNRRGRSGSSSYSNMINASTAMIALVVCAVLVALGLFATG
FT                   AVSTDVVSSMFSVERESLAPQADVSESDDHAHGHRASTRSARDEKEEEEDKVYPVEIGA
FT                   DADAIGPRAAARAAEEAARKRAAASAKLGDDAKKGARRASSKGASSKRAFSRKASSLGD
FT                   AARMRPKGVSGEDASSFATRSTSKGPESAGTAKAADAGAKLGDFQKAEEAAARMRNMGF
FT                   ASPEVPNREEPAAETEEASDESRR"
     atgttcaagc gcgaggagcc cgagaccgag aggctcttgg cctccaaccc gcgccagaag        60
     ctcacggttc accggggcca gctctacttc aacgatccgc gcgtcgccgg cgccgcggcc       120
     cccgcgtcct catcgggcca atcgcactcg gcgcgcatcg ccgagaagta cggcgggcgg       180
     cgctacttcg gcggcggatt cagcgacaac accctcgtgg atctcaacca gtccagcagc       240
     gagggcgacg tcacctccgg cactgagtac agcgactacg actacgtcac cgacgagcgc       300
     gcgcagcaga tggagcgcgg catgaggggc gcgtccgtcc cggcgggaat ccagacccgc       360
     accgccgtgt ccaacaggcg cggcaggagc ggatcctcct cgtactccaa catgatcaac       420
     gcgtccaccg cgatgatcgc gctcgtcgtg tgcgccgtcc tcgtcgccct cggcctcttc       480
     gccaccggcg ccgtgtccac cgacgtcgtc tcgtccatgt tctcggtgga gcgcgaatcg       540
     ctggcgcccc aggcggacgt ctccgagtcc gacgaccacg cgcacgggca ccgcgccagc       600
     acgcgcagcg cccgcgacga aaaggaggag gaggaggata aggtgtaccc ggtcgagatc       660
     ggagccgacg ccgacgccat cggtccccgc gccgccgcga gggcggcgga ggaggcggcc       720
     aggaagagag ccgccgcctc cgccaagctc ggcgacgacg cgaagaaggg ggcgagaaga       780
     gcttcctcga agggggcgtc ctcgaaaagg gctttttcgc ggaaggcgtc ctcgctcggc       840
     gacgcggcgc gcatgcgccc gaagggagtc tcgggtgagg acgcgtcatc attcgcgacc       900
     cggtcgactt cgaaggggcc cgagtcggcg gggacggcga aagccgccga cgcgggcgcg       960
     aagctgggcg actttcagaa ggcggaggag gcggcggctc gcatgaggaa tatggggttc      1020
     gcgagccccg aggtacccaa tcgcgaggag cccgccgcgg agaccgagga ggcctccgac      1080
     gagtcccggc gttga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page