(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE416

MICSR_1.PE416        Location/Qualifiers
FT   CDS_pept        join(<816125..816938,816978..>817258)
FT                   /codon_start=1
FT                   /gene_family="HOG000197965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637046"
FT                   /orf_name="MICPUN_67316"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /protein_id="ACO61800.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG664131"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="UniParc:UPI000199AA65"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U3"
FT                   /transl_table=1
FT                   /translation="SPLGAYERLSKQGVLRWDEAQHRALKTLNELHAKLVGDMDGGAAA
FT                   AKRKSEAPKKEGSWFTDLFTAREEDDEGGYASHGGVYLFGGPGCGKTFCMDLFYASLPG
FT                   TDGKEKRREHFHSFMLHTHQTLHKLGKAGHTEDTVAIYAQRVAKKTRVLCLDEFQVTDV
FT                   ADAMIIRRLLDQLWERGVTIVTTSNREPDELYKNGLNRVQFLPCIEAIKARCVVHPMES
FT                   VRDYRLTGRGIAGEDTTGGESGGFKGTWRVRREGESHEEGERWLERRLQPMGGRRIQVP
FT                   RAGGGVALFRFDEVCASAMGAGDYTAVASTFHTVGLSRVPRMTIERVDLMRRFITFIDV
FT                   MYEHKVKLLACAPTSPATLFESSGG"
     tcgccgttgg gggcgtacga gaggctgtcc aagcaggggg tgctccggtg ggacgaggcg        60
     cagcacaggg ccttgaagac ccttaacgag cttcacgcca agctcgtggg agacatggac       120
     gggggcgccg ccgcggcgaa gagaaagtcg gaggcgccga agaaggaggg gagctggttc       180
     accgacctgt tcaccgccag ggaggaggac gacgagggcg gatacgcgtc ccacggcggc       240
     gtctacctct tcggcgggcc cgggtgcggt aagactttct gcatggacct cttctacgcc       300
     tcgttgcccg gaaccgacgg caaggagaag cgtcgcgagc actttcactc cttcatgctg       360
     cacacgcacc agacgcttca caagcttgga aaagccgggc acaccgaaga tacggtggct       420
     atatacgcgc aacgggtggc gaagaagacc agggtcctgt gcctggacga atttcaagtc       480
     acggacgtcg cggacgcgat gatcattcgc cgtttactgg accagctgtg ggagcggggc       540
     gtgacaatcg tgacgacgtc gaacagggaa cccgacgagc tctacaaaaa cgggctcaac       600
     cgcgtgcaat tcctcccttg catcgaggcc atcaaggcac gatgcgtggt gcacccgatg       660
     gagagcgtgc gggactacag gctcacgggg cgggggatcg cgggggagga taccacgggg       720
     ggtgagagcg gcgggttcaa gggcacgtgg cgggtccgaa gggaagggga gtctcacgag       780
     gagggtgagc gctggctcga gcggcgcctc cagcccatgg gcgggcggcg gatccaggtc       840
     cccagggcgg gcggcggcgt cgcgctgttc cgcttcgacg aggtctgcgc gtccgcgatg       900
     ggagccgggg actacaccgc cgtggcttca acgtttcaca ccgtcggtct atcccgggtc       960
     cctcggatga ccatcgagcg agtggacctg atgcgccggt tcatcacgtt catcgacgtc      1020
     atgtacgagc acaaggtgaa gctgttggct tgcgcgccga cgtccccggc gacgctgttt      1080
     gaatccagcg gcggc                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page