(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE417

MICSR_1.PE417        Location/Qualifiers
FT   CDS_pept        complement(817779..818204)
FT                   /codon_start=1
FT                   /gene_family="HOG000004132" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637047"
FT                   /orf_name="MICPUN_56998"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62229.1"
FT                   /db_xref="HOGENOM:HBG731751"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199AA66"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U4"
FT                   /transl_table=1
FT                   /translation="MARSPHYSHTLVIRYSECDQQGVVFNAHYQAMCDCVMDLWLRDRM
FT                   GLAWVNDVVTNGGGFSMVVASEFKYISPAKFLDDLTISGEVLRWGTTSFEVGYVGEVHS
FT                   RRCFEGKLTYVAVDPDAKPTPVPAEFRERMTAKRSRL"
     atggcccggt cgccgcacta cagccacacg ctggtcatcc ggtactcgga gtgcgaccaa        60
     caaggggtgg tgttcaatgc gcactaccag gccatgtgcg actgcgtcat ggatctgtgg       120
     ctgcgcgaca ggatggggct agcctgggta aacgacgtgg tcaccaacgg aggggggttc       180
     agcatggtgg tggcgagcga gttcaagtac atctcgcccg cgaagttcct ggacgacctc       240
     acaatctcgg gcgaagtcct gaggtgggga accacgagct tcgaggtggg ctacgtgggg       300
     gaggtgcact ccaggaggtg tttcgagggc aaactcacgt acgtggctgt cgacccagac       360
     gccaagccga cgccggttcc ggcggagttt agggagcgaa tgaccgcgaa gcgatcgagg       420
     ttatga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page