(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE419

MICSR_1.PE419        Location/Qualifiers
FT   CDS_pept        join(complement(821244..821547),complement(820601..821142))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637337"
FT                   /orf_name="MICPUN_57000"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62230.1"
FT                   /db_xref="UniParc:UPI000199AA68"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U6"
FT                   /transl_table=1
FT                   /translation="MPKPRSRPSSDAQRRPPIRRDSTRVVNRLTTFPTHACWSEILKRS
FT                   DGKDRVVGLIQYVAMVISGGRPGSVLTSIGFALNDARRPFRLYTPVAVLIDTFLAKGKP
FT                   KTKGAMRTLECIKAISTAVYVTCDHVVWAGGAGAVDKRSTLYKVCDKLSLMGWAAGSAL
FT                   MAAGHVPDLIAYTRALRDPLASDNKRDDDVDEWELREELEEKTVASALDVASGLTQALF
FT                   ALSLLGATPLKGRQMQCVGLAMGIVGVMRQLVSVPLPPEKTGMGRMGRLPISPSMPMLR
FT                   "
     atgccgaaac ccaggtcgcg gccgtcctcc gatgcgcagc ggcgacctcc aattcgccgt        60
     gactcgacca gggtggtgaa taggctcacc accttcccta cgcacgcgtg ttggtcggag       120
     atactgaagc gttccgacgg aaaggatcgg gtcgtaggtc taatccagta cgtcgcgatg       180
     gtcatctccg ggggccgtcc cggcagcgtg ctgacgtcga ttggattcgc cttgaacgat       240
     gcgcggcgac cgttcaggct ctacacgccc gtcgcggtgc tcatcgacac cttcttagcg       300
     aaaggtaagc ccaagacgaa gggcgcgatg cgcacgctcg agtgcatcaa ggccatcagc       360
     acggcggtat acgtcacgtg cgaccacgtg gtctgggcgg gaggcgcggg ggcggtcgac       420
     aagcgatcga cactttacaa ggtgtgcgac aaactgtcgc tgatgggatg ggccgccgga       480
     tcggcgttga tggccgcggg gcacgtgccg gacctgatcg cgtacacgag ggcgcttcgc       540
     gacccgctgg cgagcgataa caagcgggac gacgacgtcg acgagtggga gctacgggag       600
     gagctcgagg agaagacggt agcgtcggcg ttggacgtgg cgtcgggtct cacgcaggcg       660
     ctcttcgcgc tgtccctgct cggggcgacg cccctgaagg gacgacagat gcagtgcgtg       720
     ggtctggcga tggggatcgt gggtgtgatg cgacagctgg tgtcggtgcc gttgccgccg       780
     gagaagacgg ggatggggcg gatggggcgg ctgccaattt cgccatccat gcccatgctc       840
     cggtag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page