(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE42

MICSR_1.PE42         Location/Qualifiers
FT   CDS_pept        83178..83663
FT                   /codon_start=1
FT                   /gene_family="HOG000216641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636047"
FT                   /orf_name="MICPUN_56615"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61605.1"
FT                   /db_xref="HOGENOM:HBG735283"
FT                   /db_xref="UniParc:UPI000199AB31"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R9"
FT                   /transl_table=1
FT                   /translation="MGRCPTGGGKKTSKQKNRGYACKSVKRTKFQLPHADVIYKAVHQH
FT                   LKEQAEGGGAKRPGKAREISSYEAMIKGDPNQPFNEDLPGGGQFYCMFTGRHFESAEAL
FT                   ARHQKTKQFKRDKKRVLNGPKPHEQRDAEAAAGMGAPDNGRPLNRAPKQAPAAMAVE"
     atgggtaggt gtcccaccgg cggaggcaag aagacctcca agcagaagaa ccgcgggtac        60
     gcgtgcaagt ccgtcaagcg caccaagttc cagctccccc acgccgacgt gatttacaag       120
     gctgtgcacc agcacctgaa ggagcaggcc gaggggggcg gcgctaagcg accgggcaag       180
     gcgagggaga tctcgagcta cgaggcgatg attaagggcg acccgaacca gccgttcaac       240
     gaggaccttc cgggcggtgg gcagttctac tgcatgttca ccgggcggca cttcgagagc       300
     gcggaggcgc tcgcgaggca ccagaagacg aagcagttca agagggacaa gaagagggtg       360
     ctcaacgggc cgaagcccca cgagcagagg gacgcggagg ctgcggcggg gatgggcgcg       420
     ccggataatg gcaggccgct caacagggct cccaagcaag ccccggccgc catggcggtc       480
     gagtga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page