(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE420

MICSR_1.PE420        Location/Qualifiers
FT   CDS_pept        join(821684..822127,822308..822755,822933..823807)
FT                   /codon_start=1
FT                   /gene_family="HOG000237536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637338"
FT                   /orf_name="MICPUN_80171"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61802.1"
FT                   /db_xref="HOGENOM:HBG560198"
FT                   /db_xref="InterPro:IPR019140"
FT                   /db_xref="UniParc:UPI000199AA69"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U7"
FT                   /transl_table=1
FT                   /translation="MSAPLPSCVTDPLGAVASAFDAAIGSGDTAPDQDGDWGIKATLQE
FT                   ALDRPGVMEQIPEINAVGVDNVRPGQLVRFRCMVQDMYNPEYYVGAYKDRSTGGKWRTT
FT                   KFTERISGGNSVNTGESQPDDSAERVIWERRVLYCVPIPGESSWIARDDEDMVAKILAA
FT                   AGERKEGPAAKVDEKVDEKAASSNPVAKHPRADHATCPPASIVPEAAESMDESLNLPLG
FT                   ATDVADGLPRAAPAIVKVYESEDALPVKLNDVLELVGVLQIEPDISNDVSNTNNDQQQA
FT                   AMAAAAAAVNGDPATSGAIEAPAEIRTALIQHLAVPLGGDVLAAEYVLAAIVSRVHTRT
FT                   DSLALGKLSVTLMGVPEGGDLPRNLAAAIADIAPCVAHLPLSIAGLNARSWTPKKDYGV
FT                   NRLRSGPLQLAPGTVVVLDETALTSGQLRETGVRNVQALKQLVQLQELEYDFQYHQMRV
FT                   PVDVAVVVLTSAKQGDSVVQGGECRVPLRMVKDTRVAEQLDPVMARTMRRFVARAWGSD
FT                   HSISEKAGKEIESEMVAARQGERKATELEFHRWLTIARLCALSSGETDLTVKHWKHAME
FT                   CERKTEERLRLM"
     atgtccgcgc cccttccgag ctgcgtgacc gaccctctgg gcgccgtggc gtccgcgttt        60
     gacgccgcga tcggctccgg cgacaccgct cccgatcagg acggcgactg ggggatcaag       120
     gcgacgcttc aggaggctct cgatcggccc ggcgtcatgg agcagatccc cgagatcaac       180
     gccgtgggcg tggacaacgt gcgcccggga cagctggtcc gcttccgctg catggtgcag       240
     gacatgtaca acccggagta ctacgtcggc gcatacaagg acaggagcac gggcggcaag       300
     tggaggacca ccaagttcac cgagaggatc tcgggcggca actcagtcaa cacgggcgag       360
     agccaacccg acgactccgc cgagcgcgtg atctgggagc gacgcgtgct ctactgcgtt       420
     ccgatcccgg gcgagagctc ttggatcgcg agggacgacg aggacatggt cgcgaagatc       480
     ctcgccgccg ccggagagcg caaagaaggt cccgccgcga aggtcgacga gaaggtggac       540
     gagaaggctg cctcctccaa cccggtggcg aagcacccac gagccgacca cgcgacgtgt       600
     cctccggcgt cgatcgtccc ggaagccgcc gagagcatgg acgagtccct gaacctaccg       660
     ctcggggcca cggacgtcgc cgacgggctc ccgcgcgcgg cgcccgccat cgtcaaggtt       720
     tacgagagcg aggatgcgct gcccgtgaag ctcaacgacg tcctcgagct cgtcggcgtc       780
     ttgcagattg aacccgacat ctcgaacgac gtctcgaaca cgaacaacga ccagcagcag       840
     gcggcgatgg cggcggctgc ggcggcggtc aacggcgatc cggccaccag cggggcgatc       900
     gaggcaccgg cggagatacg aaccgcactc atccagcacc tcgccgtccc gctgggcggc       960
     gatgtcctgg ctgccgagta cgtgctcgcg gcaatcgtca gccgcgttca caccaggacc      1020
     gattcgttgg ctctcggtaa actgtcggtg actctcatgg gagtccccga gggcggcgac      1080
     ctgccgcgaa acctcgcggc ggccatcgca gacatcgctc cgtgcgtcgc gcacttaccg      1140
     ctgtcgatcg cgggcctaaa cgcgaggtcc tggaccccga agaaggacta cggggtcaac      1200
     cggcttcgat ccgggccgct tcaactggct cccgggacgg tcgtcgttct cgacgagacc      1260
     gcgctgacgt ccgggcagct gcgggagacg ggcgtgagga acgtgcaggc gctcaagcaa      1320
     ctcgtgcagc ttcaggagct ggagtacgac ttccagtacc accagatgcg ggtgcccgtc      1380
     gacgtcgccg tcgtcgtctt aacatccgcg aagcaagggg acagcgtcgt gcaggggggc      1440
     gagtgcaggg tgccgctgcg catggtcaag gacacgcgcg tcgccgaaca gctggacccc      1500
     gtcatggcga gaacgatgcg ccggttcgtg gccagggcgt ggggaagcga ccactccatc      1560
     agcgaaaagg cgggcaagga gattgagtcc gagatggtcg ccgcgcggca gggcgagcgc      1620
     aaggcgacgg agctggagtt tcacaggtgg ctgaccatcg ccaggctttg cgcgctgagc      1680
     tcgggggaga cggatttgac ggtgaagcac tggaagcacg cgatggagtg cgagaggaag      1740
     acggaggaga ggctcaggct catgtag                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page