(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE421

MICSR_1.PE421        Location/Qualifiers
FT   CDS_pept        823907..825292
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637339"
FT                   /orf_name="MICPUN_57002"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61803.1"
FT                   /db_xref="HOGENOM:HBG608447"
FT                   /db_xref="UniParc:UPI000199AA6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U8"
FT                   /transl_table=1
FT                   /translation="MGAPDLLTRSFAPRITFVDMAEKWRDNQPAVSVAFAGVNRARRAR
FT                   AAAADASADAAEASLGRADLMPRDDTVDATRIASGASSSRGDDGDKGSESRAAWSVALG
FT                   TGLERWIADRGIVVSEPKHFVDVEALYDLYVRDVHPEGKAPNLVTFSSMAGKTLRRVLA
FT                   PATLARRVGKLSVTCEALPATRENWPPRMANKKAEKIKKHGPKDPGRSRPHDLVKQDKD
FT                   STGATCARYVSEMLKLACGPELVRLRVFPDAKELTEAFAASNAIRTHLWSRYKPNDERV
FT                   CLIAVGDGNTPRSAALCAFLTRWQCVAVDPEMVPWRDWRRRHKIQDATWSSCEVKEGDE
FT                   IDEEGDTHGWGGVRRLQVHRRKMQEMVVECELALIVMIHAHISLKDVLAAVKTKSGECA
FT                   AVILPCCNWYSRLAHPDGATAPCHEYEDDAVVSPQRTVRVFSSLPCGVSGAGDGVPCPE
FT                   VVA"
     atgggcgccc ccgaccttct cacgcgctcg ttcgcgccgc ggatcacgtt cgtggatatg        60
     gctgaaaagt ggcgcgataa tcagcccgcg gtttccgtcg cattcgccgg cgtcaacagg       120
     gcgcgaaggg cgcgtgccgc cgccgccgac gcgagtgctg atgcagccga agccagcctc       180
     ggaagagccg acctgatgcc gcgggatgac accgtcgatg cgaccaggat cgcatcgggc       240
     gcgtcatcaa gccgcggcga tgacggcgac aaaggatcag aaagccgcgc ggcgtggagc       300
     gtcgccctcg gcacgggact cgagcgatgg atcgcggacc gaggcatcgt cgtgagcgag       360
     cccaagcact tcgtcgatgt ggaggccctc tacgacctct acgttcgcga cgtgcacccg       420
     gaaggcaaag ccccgaacct cgtcacgttc agtagcatgg ccggcaagac cctgcgtagg       480
     gtcctcgcgc cggcgacgct cgcgcgacgc gtcggaaagc tcagcgtcac ctgcgaggct       540
     ctgccggcca ctcgagagaa ctggccgccg cggatggcga acaagaaggc tgagaagata       600
     aagaagcacg gcccgaagga ccccgggcgg tctcgacccc acgacctcgt aaagcaggat       660
     aaggactcca ccggcgcgac gtgcgcgagg tacgtgagcg agatgctgaa gctcgcgtgc       720
     ggccccgaac ttgttcggct ccgagtcttc ccggacgcaa aggaactcac cgaggccttc       780
     gccgcatcca acgccatacg aacgcatctc tggagccgtt acaaaccgaa cgacgagcgc       840
     gtgtgtttga tcgcggtcgg ggacgggaac acgccgagga gcgctgcgct ttgcgcgttc       900
     ctgaccaggt ggcagtgcgt ggcggtggac cctgagatgg tgccgtggcg cgactggcgg       960
     agacggcaca agattcagga cgcgacatgg agctcatgcg aggtcaagga gggtgacgaa      1020
     atcgacgagg aaggggatac gcacgggtgg ggtggggtcc ggcggctgca ggtgcacagg      1080
     cgaaagatgc aggagatggt ggttgaatgc gaactcgcgc tgatcgtcat gatccacgcg      1140
     cacatctcgt tgaaggatgt tctggcggcg gtgaagacca agtccgggga gtgcgcggcc      1200
     gtgatcctgc cgtgctgcaa ctggtactcg aggctggcac acccggacgg tgcgacggcg      1260
     ccgtgtcacg agtacgagga cgacgcggtc gtttcgccgc agcggacggt gcgagtgttt      1320
     tcttcgctcc cgtgcggcgt gtcgggcgca ggcgacggcg tgccctgtcc ggaggttgtc      1380
     gcgtag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page