(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE422

MICSR_1.PE422        Location/Qualifiers
FT   CDS_pept        join(complement(826121..826179),complement(825392..826007))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637340"
FT                   /orf_name="MICPUN_52244"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62231.1"
FT                   /db_xref="UniParc:UPI000199AA6B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U9"
FT                   /transl_table=1
FT                   /translation="MGGGDFVGDYGSVQDRNAERSRFHADLAESQWHTLGDLLERKRSS
FT                   NPRSMLVAVKKFVTGHGKGLGSAPFLLGLRAFLEAQRGGTECVAWVLSPAVFTQSGGEI
FT                   WMRDAVDAIASGADRRVDLEGDDGNDIPLSDADKRLAWSLPLQFRDGDIDEVLSQIPSK
FT                   ARLEDAGCGPTGEIVRHGAHPPGAPARTAGTGKRRGCRARCCFLPFLFVAATVCCVVVL
FT                   VR"
     atgggtgggg gtgactttgt gggtgactat ggatcggtcc aggatcgcaa cgccgagcgc        60
     tctcgattcc acgcagacct cgccgagtcc cagtggcaca cgctcggtga cctcctggaa       120
     agaaaaaggt catcaaaccc caggtctatg ctcgtcgcgg tgaagaagtt cgtgacggga       180
     catgggaagg gcctcggttc cgcgcccttc ttgctcggcc tccgcgcgtt cctagaggcg       240
     cagaggggcg gaacagagtg cgtggcctgg gtgttatccc ccgcggtctt cacgcagtcc       300
     ggcggggaga tctggatgag ggacgcggtc gacgcgatcg cttcgggggc ggaccgaagg       360
     gtggacctcg agggcgacga cggaaacgac attcctctct cggacgcgga caagaggctc       420
     gcgtggtcgc tgccgctcca gtttcgcgac ggggacatcg acgaggtgct gtcgcagata       480
     cccagcaagg cgcgcctgga ggacgcgggt tgcggaccca cgggtgagat cgtgaggcac       540
     ggcgcgcacc cgccgggcgc gccggcgagg acggcgggca cgggcaaacg gcgcggctgt       600
     cgcgcgaggt gctgcttcct gccgttcctc tttgtcgccg ccaccgtgtg ctgcgtcgtc       660
     gtgctggtgc gttag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page