(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE423

MICSR_1.PE423        Location/Qualifiers
FT   CDS_pept        complement(826512..827135)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637341"
FT                   /orf_name="MICPUN_107924"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62232.1"
FT                   /db_xref="UniParc:UPI000199AA6C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V0"
FT                   /transl_table=1
FT                   /translation="MQAITSLFTVKPVTRRPKVAKRGSLQVVAHGGVGGSGGTQYPGKD
FT                   KPYGSDQAPWKKKLILHDDDQADPEANQRSGQRWTPPPPKQESFAAAAPAQSTSSWDSP
FT                   SSGSGGSSNAYSWDSGGSSSYSSAGSAKGRPTHYDPDQYDPDANQRGYMGGGGGGGYSA
FT                   PKPSYGGSTGGGYAAAKPQRVTRGSDGVTYDPDQYDPDANQRSR"
     atgcaggcga tcacctctct gttcaccgtc aagccggtca cccgccggcc caaggtcgcc        60
     aagcgcggct ccctccaggt cgtcgcccac ggcggcgtgg gcggatccgg cgggacccag       120
     taccccggca aggacaagcc gtacggctcc gaccaggcgc cctggaaaaa gaagctcatc       180
     ctccacgacg acgaccaggc tgaccccgag gccaaccagc gcagcggtca gcgctggacc       240
     ccgccacccc ccaagcagga gtccttcgcc gccgccgctc ccgcgcagtc cacatcctcc       300
     tgggactccc catcctcggg atccgggggt tcctccaacg cctacagctg ggactccggc       360
     ggttcctcct cctattcctc ggcgggctct gccaagggcc gacccacgca ctacgacccc       420
     gaccagtacg accccgacgc caaccagcgc ggctacatgg gcggcggcgg cggcggcggc       480
     tactctgccc ccaagcccag ctacggggga tccaccggcg gcggctacgc ggcggccaag       540
     ccgcagaggg tcacgcgcgg ctcggacggc gtgacctacg acccggatca gtacgatccc       600
     gacgcgaacc agaggtccag gtga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page