(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE425

MICSR_1.PE425        Location/Qualifiers
FT   CDS_pept        join(complement(832753..832814),complement(829304..832625))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637343"
FT                   /orf_name="MICPUN_99502"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62233.1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniParc:UPI000199AACB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V2"
FT                   /transl_table=1
FT                   /translation="MSSLVSQLTAKTPATGKRSSRRKLGGTVSIVGTDVNEEVVSRALP
FT                   AITPGTKAKPLRKPLGERTNGATTAKKTRGLDDDAVTGLTNALKTAAKAAKKKDGDIAS
FT                   KENGADYSEFADLPTDPLERGLALVRKGVEAMRTGGVDPKEALLKFAKKPKSGPNVREA
FT                   AATVVNRLLETLEAAADDKSDTSRELDYSGGSDDENNESEVVEAVGDDDEEVEEDDSED
FT                   VFATATNSPVKSISGASDSAGVAADDLSAALQGMTVTVEEGVMGCGDESCGSGPDGACD
FT                   PLECMRRAGGPFKMPAKLVKQPSTVSTARSSPPEEKDAPVVGEKEEDEDDEDEEEDANE
FT                   STAEESVLATDDDDEDDADEEDDDESVADTASVAGTDSQEESSMADLAAVEAAAEADAA
FT                   EGSPMMSPGPEVVDVSDLPDGTPLAEPVPDAPIVIDADDTDEECDDDDEVTSKATPPAM
FT                   NATVREKLDSSAEDDAADETGYQEDDDEMPVSARRTPGRRSRAVVDSSDEDEADDEKAS
FT                   SREGEEGEGSGESPSIGTPPAANTPPAQPVFNAPPPTTGRRSILRRIASNMKMRAQREA
FT                   REAAMRAPNFDDDAASSELSAAANAPAPALAATQPKAFPKSALKKSSKYAAAPAPEPEV
FT                   SEEASTAADAVTPARRRPQRRAVIESARKKALAWIDDEASDDGDDDDDEDEDEACSADD
FT                   DFVCDDDDVEYDSDASSNAIAEDMHARSGGVMPNVTPSPEVPKTVSRAPKSILKGRTPG
FT                   KTPGKGSRLTFGDDDVKHMTDSEGEGSSPEPDENDPRLPRTMVAKGTAQDPYGLDDLKT
FT                   PTPPRPLAEVLNEARTPSWAKTPNTAGRKTVGFGASFGNEPPPTHSKALAAALASAAKP
FT                   GKTLNYGKHKETIARALYNEFNADAFDGKLPAKLDISWNAKLLTTAGLTHYKKVTRSTG
FT                   LSEYSARIELSTKVLDCAEKLEATLLHEMCHAAAWLLDHQAKPPHGATFKKWAKQAMRT
FT                   YPDVSVDTCHSYEIFQPYRYRCTQQWCNTEYGRHSKSIDVEAKACGVCNGRLEYLGKFN
FT                   PDGSKAEEKPPTAFSLFVKEHFAATKERMPAGTPHKNIMKELSGLWKSGGGTTGKKTRG
FT                   GDDEALSPDALGESMRTLKL"
     atgagcagcc tggtgagcca gctgacggcc aagacccccg ccacggggaa acgctcgtcg        60
     aggcgtaagc tcggcgggac cgtctccatc gtcggcacgg acgtcaacga ggaggtcgta       120
     tctcgcgcgc ttcccgcgat caccccggga accaaggcta agcctctgcg caagcccctc       180
     ggcgagcgca ccaacggcgc cacgaccgcg aagaagaccc gcggtctcga tgatgacgcg       240
     gtgaccggcc tgaccaacgc gctcaagacc gcggcgaaag cggccaagaa gaaagacgga       300
     gatatcgcgt ccaaggagaa cggtgcggat tactccgaat ttgcagacct cccgacggac       360
     cctctcgagc gcggcctggc gctcgtgcgc aagggcgtcg aggcgatgcg cacgggcggt       420
     gtggacccga aagaggcgct gctcaagttc gccaagaagc caaagtccgg gcccaacgtc       480
     agggaggccg cggcgaccgt ggttaacagg ctcctcgaga ccctcgaggc tgcggcggac       540
     gataaatcgg acacgtcgcg cgagctcgat tacagcggcg gctccgacga tgagaacaac       600
     gaatccgagg ttgtcgaggc tgtcggcgac gacgacgagg aggtggagga ggatgactcc       660
     gaagacgtct tcgcgaccgc caccaactcc ccggtaaaat ccatcagcgg tgcaagcgac       720
     agcgcgggcg tcgccgccga tgacctctcc gccgctctgc agggcatgac ggtgacggtg       780
     gaggagggcg tgatgggctg cggcgacgag agctgcggct cgggcccgga cggcgcgtgc       840
     gacccgctgg agtgcatgag gcgcgcgggg gggcctttca agatgcccgc gaagctcgtc       900
     aagcagccat cgaccgtgtc caccgctcgt tcgtcgcccc cggaggaaaa ggatgctccc       960
     gtcgtgggcg agaaggagga ggacgaggat gacgaggacg aggaagagga tgcgaacgag      1020
     tccaccgcgg aggagtctgt cctcgcgacc gacgacgacg acgaggacga cgccgatgag      1080
     gaggacgacg atgagtccgt ggccgatacc gcatccgtcg caggcaccga cagccaggag      1140
     gagagctcca tggccgacct cgccgccgtg gaggctgcag cagaggctga cgccgcggag      1200
     ggctcgccga tgatgtcgcc cggtcccgaa gtcgtcgacg tctccgacct ccccgacggt      1260
     accccgctag cggaacccgt cccggacgcg cccatcgtca tcgacgccga cgataccgac      1320
     gaggagtgcg acgacgacga cgaggtgacc agcaaggcga cgccgccggc gatgaacgcg      1380
     acggttcgcg agaagctgga cagctccgcc gaggacgacg ccgcggacga gaccggatac      1440
     caggaggacg acgacgagat gcccgtgagc gcccgtcgca cccccggtcg cagatcccgg      1500
     gccgtcgtgg acagcagcga cgaggacgag gctgacgacg agaaggcatc gtcgcgggag      1560
     ggggaagaag gggagggatc gggcgagtcc ccgtcgattg gaacgccccc cgcggcgaat      1620
     accccacccg cgcagccggt tttcaacgcg ccgcccccaa ccaccggcag gagatccatc      1680
     ctgcggagga tcgcctcaaa catgaagatg cgggcgcagc gcgaggcgcg cgaggcggcg      1740
     atgcgcgccc cgaactttga cgacgacgcg gcgtcctcgg agctgtccgc cgccgcgaac      1800
     gccccggcgc cggcgctcgc cgcgacgcag ccgaaggcgt ttcccaaatc cgcactcaag      1860
     aagtcgtcca agtacgccgc cgcgccagcg ccggagcccg aggtttctga ggaggcctcc      1920
     accgccgcgg acgccgtcac ccccgcgagg cgcaggcccc aacgcagggc tgtgatcgag      1980
     tcggcgagga aaaaagcact cgcgtggatc gacgacgagg cttccgacga tggggacgac      2040
     gacgacgatg aggacgagga cgaggcgtgc tccgccgacg atgacttcgt ctgcgacgac      2100
     gacgacgtcg agtacgactc cgacgcatcg tccaacgcca tcgcggagga catgcacgcg      2160
     cgcagcggcg gcgtgatgcc caacgtgacc ccgtccccgg aggttcccaa gactgtctct      2220
     cgcgcgccca agagcatcct caagggtcgc accccgggga agacccccgg caagggcagt      2280
     cgcctgacgt tcggcgacga cgacgtcaag cacatgaccg actcagaggg tgagggcagc      2340
     tcgccggaac ccgacgagaa cgatccgagg ctgccccgca cgatggtggc caagggaacc      2400
     gctcaggacc cctacggact cgacgacctc aagaccccga cgcccccgcg gcccctcgcg      2460
     gaggtgctca acgaggcgag aaccccgagc tgggccaaga cgcccaacac cgccggcagg      2520
     aagaccgtcg gattcggcgc gtccttcggg aacgagccgc cgccgacgca cagcaaggct      2580
     ctcgccgcgg cgctcgcgtc ggcggccaag ccgggaaaga ccctcaacta cggcaagcac      2640
     aaggagacaa tcgcgagggc gctgtacaac gagttcaacg cggacgcctt cgacgggaag      2700
     ctgcccgcca agctggacat ctcctggaac gccaagctgc tcaccaccgc gggattgacc      2760
     cactacaaga aggtgacgag gagcactggc ctgagcgagt acagcgccag gatcgagctg      2820
     tccaccaagg tgctcgactg cgcggagaag cttgaggcta ctctgctgca cgagatgtgt      2880
     cacgccgcgg cttggctcct cgaccaccag gccaagcccc cgcacggcgc aacgttcaag      2940
     aaatgggcga agcaggcgat gcgaacctac cccgacgtct ccgtcgatac ctgccactcg      3000
     tacgagatct tccagccgta caggtacagg tgcacgcaac agtggtgcaa caccgagtac      3060
     ggccggcact ccaagtccat cgacgtcgag gccaaggctt gcggtgtatg caacggtcgg      3120
     ctggagtatc tcggcaagtt caaccccgac ggcagcaagg cagaggagaa gcccccgact      3180
     gcgttcagcc tctttgtcaa ggagcacttc gcggcgacga aagagaggat gcccgcgggg      3240
     acgccgcata agaacatcat gaaggagctc agcggtttgt ggaagagcgg cggcgggacc      3300
     accgggaaga agacccgggg cggggacgac gaggcgctgt cgccggatgc gctgggcgag      3360
     agcatgcgca cgctcaagct gtga                                             3384
//

If you have problems or comments...

PBIL Back to PBIL home page