(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE426

MICSR_1.PE426        Location/Qualifiers
FT   CDS_pept        833109..833492
FT                   /codon_start=1
FT                   /gene_family="HOG000264350" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637344"
FT                   /orf_name="MICPUN_57007"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61805.1"
FT                   /db_xref="HOGENOM:HBG560203"
FT                   /db_xref="InterPro:IPR008560"
FT                   /db_xref="UniParc:UPI000199AACC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V3"
FT                   /transl_table=1
FT                   /translation="MSGVQLKAVQDLQAQLTKVMEELDHKVFRPQQKAAFQCSIKCTDL
FT                   RGPQEEMHACLAKCGEPIQRHEAAVMGELQEFQHRVQRCVQQCQDKQATTQDQGKFDKC
FT                   VSECAVFYQKELASLKPQLMKKR"
     atgagcggag ttcagctcaa ggcggtccag gacctgcagg cgcagctcac gaaggtgatg        60
     gaggagctgg atcacaaggt gttccgcccc cagcagaagg ctgccttcca gtgcagcatc       120
     aagtgcaccg atctgcgagg accccaggag gagatgcacg cgtgcctggc taagtgcggc       180
     gagcccatcc agcggcacga ggccgcggtc atgggggagc tccaggagtt tcagcacagg       240
     gtgcagaggt gcgtgcagca gtgccaggat aagcaggcca ccacccagga ccagggcaag       300
     tttgacaaat gcgttagtga gtgcgccgtg ttctaccaga aggagcttgc gtccctcaag       360
     ccgcagctga tgaagaaacg gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page