(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE427

MICSR_1.PE427        Location/Qualifiers
FT   CDS_pept        complement(833646..834200)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637345"
FT                   /orf_name="MICPUN_107925"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62234.1"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="UniParc:UPI000199AACD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V4"
FT                   /transl_table=1
FT                   /translation="MEAAVGQLRQLLGLSPSPPHADIDEPKLNIRSVPASSAGFATWEV
FT                   DVLVRRRAAAGHRAAMDSLDSLAAVVKAMPEMDVPKALAEAAGESLSESRLAREAAVDG
FT                   RLEDAAVHARNSHAHAESAFFHPQIISLLYFPQEYKLAVYIPLFLPTLFPLFTGLMWDV
FT                   KFYVRRTRCAAEHRRRAGKAD"
     atggaggcgg ctgtcggtca gctgcgtcag ctcctcggcc tctccccgtc gccgcctcac        60
     gcggatatcg acgagcccaa actgaatatt cgatcggtcc cggcgtcctc cgcgggcttc       120
     gccacgtggg aggttgacgt tttggtccgt cggagggcgg ctgcggggca ccgcgcggcg       180
     atggattcgc tggattcttt agccgcggtt gtcaaggcga tgccggagat ggacgtgccc       240
     aaggctctgg ctgaggcggc gggcgagtcg ttatcggagt ccaggctcgc gagggaagct       300
     gcggtcgacg gcaggctgga agatgcggcg gtgcacgcgc gaaacagcca cgcgcacgcc       360
     gagtcggcat ttttccaccc acaaattata tcgctgctgt actttccgca ggagtacaag       420
     ctggctgtgt acatcccgct gttccttccg acgctgtttc cgctgttcac cggactgatg       480
     tgggacgtca aattttacgt gcggaggacg aggtgcgcgg cggagcaccg gaggcgcgcg       540
     ggcaaggcag attga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page