(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE428

MICSR_1.PE428        Location/Qualifiers
FT   CDS_pept        836124..837818
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637346"
FT                   /orf_name="MICPUN_57009"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61806.1"
FT                   /db_xref="UniParc:UPI000199AACE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V5"
FT                   /transl_table=1
FT                   /translation="MSQSNTGAGYDEFTPVPLTAEALAQLASQDHGLGNVARMMDNGVW
FT                   NTDGVQDDIRRESIDRDVDRYHRTLDMGKRVPRNSRRSEDAEPRISCNSNLSGFDAVGG
FT                   SFIAHLAPRYGSSSFTSRATSLAMNAIAAELDCTEVRAVSTRGSVAHETAGVQAFHSDV
FT                   ISALFVGHLDNKLDLARKCDVPTGISCAELVFHLYNDCGAAFLDQLQGFFAFCIVDAGS
FT                   ATVFAAVDRHASIPLYKARSKGGGVFIAHPGGSGSSAIKLSTLGEMSKIPAGSYVHGNR
FT                   HINPHKYARDKFAERALMEMDTLDETASVLSAGPSPFDIMDQNKTGQPAGFSSLFSSGS
FT                   LFSQSMDDLPSMEGGYPERRETTSPPKVKDVLRRRHSVEDLTKFSDGIGTWNARWNMDE
FT                   DDDDMNVVQVDGHGSESRMGESFHRARKNGSAVSNVSGLDTAPGTPSKADVGTFGKPPA
FT                   VPDERRRHVAHVEKKSSPARTRVRKSSWSNGSEEEARGKENMRRVHSDGELNSLSGRSN
FT                   PKAIPSRAKDDASVISMCRSMSTGHVSSSDALSETECYVSLSLGAGA"
     atgtcgcagt ccaatacggg agcgggctac gatgagttca ccccggtccc gctcaccgcg        60
     gaggctctgg ctcaactggc gtcgcaggat cacggtttgg gcaacgtcgc caggatgatg       120
     gacaacgggg tatggaacac ggacggcgta caggacgaca tcaggcggga atcgatcgac       180
     cgcgacgtgg accgctatca ccggaccttg gacatgggca agcgggtgcc gcgcaactcg       240
     cgtcggtccg aggacgccga accccgtatt tcgtgcaact cgaacctctc cggcttcgac       300
     gcggtggggg gcagcttcat cgcgcacctg gcaccgcgtt acggctcctc atccttcacg       360
     agtagggcga ccagcctcgc catgaacgcc atcgctgcgg agctcgactg caccgaggtt       420
     cgcgcggtca gcaccagagg atcggtcgcg cacgaaactg cgggagtcca ggctttccac       480
     tccgatgtca tatccgccct tttcgtcggt cacctggaca acaagctgga cctcgcgagg       540
     aaatgcgacg tgcccacggg aatctcgtgc gcggagctgg tcttccacct gtacaacgac       600
     tgcggcgcgg cgttcctgga ccagctgcag ggcttcttcg ccttttgcat agtcgacgcg       660
     ggatcggcga ctgtgtttgc cgccgtcgac aggcacgcgt ccatccctct gtacaaggct       720
     cggtcgaagg gcggcggggt attcatcgcg cacccgggcg gaagcggatc cagtgccatc       780
     aagctcagca ccctcggcga gatgagcaag atcccggcgg ggagctacgt ccacggcaac       840
     cggcacatca acccacacaa gtacgcgagg gataaatttg ccgagcgagc gctgatggag       900
     atggacacgc tggacgagac cgccagcgtg ttgagcgccg gaccctcccc cttcgatatc       960
     atggaccaaa acaaaacggg gcaacctgct ggattctcga gcctgttctc gagcgggtcc      1020
     ttgttctctc agagcatgga cgacctgccg tcgatggagg gtggctaccc cgagcggagg      1080
     gagacgacgt cgccgcccaa ggtgaaggac gtgctcaggc gaaggcacag cgtggaggac      1140
     ctcaccaagt tcagcgatgg gatcgggacg tggaacgcgc ggtggaacat ggacgaggac      1200
     gacgacgaca tgaacgtcgt gcaggttgac gggcacggat ccgagtcgag gatgggcgaa      1260
     tcgtttcacc gagccaggaa aaacggttcc gcggtgtcca acgtttccgg gttggacacc      1320
     gcgcccggaa ctccttcgaa agctgacgtg ggaacgttcg gcaagccccc cgcggttccc      1380
     gatgagagga gaagacacgt tgcccacgtg gagaagaaat cgtcccccgc gaggacgagg      1440
     gtgcgtaaga gcagttggtc caatggctcg gaggaggaag cgcgcgggaa ggagaacatg      1500
     cggcgggtgc actccgacgg ggagctcaac tcgctgtcgg ggcgctccaa tcccaaggct      1560
     atcccgtcgc gcgcgaagga cgatgcatcg gtcatcagca tgtgccggtc tatgagcacc      1620
     gggcacgtgt cgagcagcga cgcgctcagc gagacggagt gttacgtcag cctctcgctg      1680
     ggagcggggg catga                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page