(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE429

MICSR_1.PE429        Location/Qualifiers
FT   CDS_pept        838324..840309
FT                   /codon_start=1
FT                   /gene_family="HOG000258608" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637347"
FT                   /orf_name="MICPUN_57010"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61807.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG315546"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199AACF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V6"
FT                   /transl_table=1
FT                   /translation="MAGAVTGIPEGRATETIYGLIRDGKHDECAKLLEIQLANAPDSRP
FT                   ALSLLGYCYYYLGNFERAAEMYGQLAKLFPENEDYAVHHAQSLYKASMYQDALRASRAI
FT                   DSKDPAVRQKVSQLQALIAYEEDDLAGCRARLDECPSDDPDVVVNLACCMLKEGRFEEA
FT                   RTRFLDAQQALGFQADIAYNIALCYYRTKQFGPALKHLAEIIERGMREHPELAVGAATD
FT                   ATQTGEEIRSVGNTPALKETALVEAFNLKAAIEYAMGNSEGFREALTDMPPRTEEELDP
FT                   VTLHNVALMNMESDPTDGFHKLNFLLQSPVSPPETFGNLLLLYCKPEHGFYDLAADVMA
FT                   ENPQLVAKHLPQEVHQFLEATILAQTAPEEAYRKFEELVQRNADKLRRLTRKIQEYRQG
FT                   RDDKALKKSLAEYDETLDAYVPALMAQAKIYWDAENYQQVEKILRQGADYCADHEAYKV
FT                   NMAHTCFMQALSNDEKYVDAIQHYEPIVREKLEDESGMGVLNVTAIVLANLCVAYIMTS
FT                   QNEEAEELMRAIERAEEEVQYHDPNRQCFHLCIVNLVIGTLYCSKGNYEFGISRVIKSL
FT                   EPYDKKLETDTWFYAKRCVVALLDLLGKHMITVPDSTMDEVMAFLDEAERHGREIVTQL
FT                   GDDGQGRTLTTEARMIKKMFIKLRDL"
     atggcgggcg ccgtgacggg catccccgag ggacgggcca cggagactat ctacggcctg        60
     atcagggacg ggaaacacga cgagtgcgcg aagctgctgg agatccagct cgccaacgcg       120
     cccgattcca gacccgcgct atctctgctg ggctactgct actactacct cggtaacttc       180
     gagcgcgccg cggagatgta cgggcagctc gcaaagttat tcccggagaa cgaagactac       240
     gcagtgcatc acgcgcagag cctctacaag gcgtccatgt accaagacgc tctccgcgcg       300
     tcgagggcca tcgacagcaa ggacccggcg gtccgacaga aggtctcgca gctgcaggcg       360
     ctcatcgcct acgaggagga cgacctcgcg gggtgcaggg cgaggctgga tgagtgcccg       420
     agcgacgatc cggatgtcgt cgtcaacctc gcgtgttgca tgctcaaaga aggccgcttc       480
     gaggaggcgc ggacgcggtt cctcgacgcg cagcaggcgc tgggattcca ggcggacatc       540
     gcgtacaaca tcgcgctgtg ctactaccgc accaagcagt tcggcccggc gttaaagcac       600
     ctggcggaga taatagagag gggaatgagg gagcaccccg aactcgcggt gggcgcggcg       660
     acggatgcga cgcagacggg cgaggagatc aggagcgtgg ggaacacccc cgcgctgaag       720
     gaaaccgcgc tggtggaggc gttcaacctc aaggcggcga tcgagtacgc catgggcaac       780
     tccgagggtt ttcgggaggc gctcacggac atgccgccga ggacggagga ggagctcgat       840
     ccggtgacgc ttcacaacgt cgcgctcatg aacatggaga gcgatccgac ggacgggttc       900
     cacaagctca actttttgct gcagtcgccc gtgagcccgc cggagacgtt cgggaacctg       960
     ctcttgctgt actgcaagcc ggagcacggg ttttacgacc tcgccgcgga cgtcatggcg      1020
     gagaatccgc aactggtcgc gaagcactta ccccaggagg tgcaccagtt tctggaggcg      1080
     accatcctgg cgcagaccgc gccggaggag gcgtatcgca aattcgagga gctcgtgcag      1140
     cggaacgcgg acaagctccg aaggctgacg cggaagattc aggagtacag acaggggcgg      1200
     gacgacaagg ctctgaaaaa atctttggcc gagtacgacg agaccctgga cgcgtacgta      1260
     cccgcgctga tggcccaggc gaagatttac tgggacgccg agaactatca gcaggtggag      1320
     aagattctgc gacagggcgc ggactactgc gcggaccacg aggcgtacaa ggtgaacatg      1380
     gcacacacgt gcttcatgca ggcgctgagc aacgacgaaa aatacgttga cgcaattcag      1440
     cactacgagc cgatcgtgcg ggaaaagctg gaggatgaga gcggcatggg ggtgctgaac      1500
     gtgacagcga tcgtgctggc gaacctttgc gtcgcgtaca tcatgacctc gcagaacgag      1560
     gaggcggagg agctgatgcg cgccatcgaa cgtgcggagg aggaggtaca gtatcacgac      1620
     cccaacaggc agtgcttcca cctatgcatc gtgaacctag tcatcggcac gctctactgc      1680
     tccaagggca actacgagtt cggaatctcg cgggtgatca aaagcttgga gccgtacgat      1740
     aagaagctgg agacggacac ctggttctac gccaagcgat gcgtcgtcgc gctgctcgac      1800
     ttgctcggca agcacatgat caccgtgccg gactccacta tggacgaggt gatggcgttc      1860
     ctggacgagg cggagaggca cgggagggag atcgtgacgc agctagggga cgatgggcaa      1920
     ggacggacgc tcaccacgga ggcgcggatg atcaagaaga tgttcatcaa gctcagggac      1980
     ctttag                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page