(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE43

MICSR_1.PE43         Location/Qualifiers
FT   CDS_pept        complement(83764..84849)
FT                   /codon_start=1
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636048"
FT                   /orf_name="MICPUN_99249"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO62050.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG714097"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AB32"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S0"
FT                   /transl_table=1
FT                   /translation="MAADPTAAGPGGLSEEQAAVYDRQLRVWGVEAQRRLGASRILVAG
FT                   LTGLAAEACKNVALAGVGALVLYDDGAPAVDAAPGNFLAASGLADAAGTADADALTVAN
FT                   ATAATLREMNPFGEISILPGPSDLSGIDAAAVKGCDAVLVTGCSLAVAERINDACRDAG
FT                   ASFFYGECRATVANFFADLGPNFRYAVERGRSNTAEKDGDAANNAGADAAVVSSFVPLR
FT                   EAVTCKWCTLGDGREGGVRRVNRLAPAWLLSKRFERSLKRPPSAQDVPTMLAEVPALEK
FT                   EHGVKPGWLGDARWAVEDVVAGASGVGDGGESPAVAAVVGGILAQEVLRSVTGKGEPVR
FT                   NSFFFGVRNGQGTVENMGCPT"
     atggctgcgg atcccaccgc cgccggtcca ggcggcctct ccgaagaaca ggccgcggtg        60
     tacgaccgcc agttgcgcgt ttggggggtc gaggcgcagc gtaggctcgg cgcatcgcgc       120
     atcctcgtcg cgggtcttac cggcctcgcc gccgaggcgt gcaagaacgt cgcgctcgcg       180
     ggcgtcggcg ccctcgtcct ttacgacgac ggcgccccgg cggtggatgc cgcgcccgga       240
     aacttcctcg cggcgtcggg gctcgcggac gctgcgggaa ccgccgacgc ggacgccctc       300
     accgtcgcca acgccaccgc cgcgacgctg cgcgagatga accccttcgg cgagatctcg       360
     atcctcccgg gaccgagcga tctgtcgggg atcgacgcgg cggcggtgaa gggatgcgac       420
     gcggtgctcg tcaccggatg ctcgctcgcc gtcgcggaga ggatcaacga cgcctgccgc       480
     gacgccggcg cgtccttctt ctacggcgag tgtcgagcca ccgtcgccaa cttcttcgcc       540
     gatctcgggc caaacttcag gtacgccgtc gagagaggac gttcaaacac ggcggagaag       600
     gacggagacg cggctaacaa cgccggcgcg gacgccgccg tcgtctcgtc gttcgtcccg       660
     ctgcgagagg cggtgacctg caagtggtgc accctgggcg acggcaggga gggcggggtg       720
     aggcgggtca acaggctcgc gcccgcgtgg ttgctttcaa agcgtttcga gcgatcgctt       780
     aaacgccctc cgtccgctca agacgtcccc acgatgctcg cggaggtgcc cgcgctggaa       840
     aaggagcacg gggtgaagcc cgggtggctc ggggacgcgc ggtgggctgt ggaggacgtc       900
     gtggccgggg cttcgggggt gggcgacggg ggggagtcac cggcggtggc ggcggtggtt       960
     ggcgggatcc tcgcgcagga ggtgctcagg tcggtcaccg ggaaggggga gccggtgcgg      1020
     aactcgttct tcttcggcgt gaggaacggt caggggacgg tggagaatat ggggtgcccg      1080
     acgtga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page