(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE430

MICSR_1.PE430        Location/Qualifiers
FT   CDS_pept        complement(<840761..>842197)
FT                   /codon_start=1
FT                   /gene_family="HOG000175620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637348"
FT                   /orf_name="MICPUN_67015"
FT                   /product="Predicted protein"
FT                   /function="gamma-glutamyltransferase activity"
FT                   /protein_id="ACO62235.1"
FT                   /db_xref="GO:0003840"
FT                   /db_xref="HOGENOM:HBG738311"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="UniParc:UPI000199AAD0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V7"
FT                   /transl_table=1
FT                   /translation="GAVAADEARCSAIGAAVLDDGGHAVDASIATALCLGVTHPHSSGV
FT                   GGGAFMVIRLANGTTEAIEFRESAPAAAYRDMYVDGSGANGANRSSTFGGAAVAVPAEL
FT                   AGLHLAWERHGRLPWRRLVEPAALLANGFEVGKDLAREIADMAEDLAKFPVTKEVFLKA
FT                   DGSPLLEGETCANTRLAATLRRVANEGPSVLRTGELADALAKDIRDAGGVMESSDLAAY
FT                   RPRIFEPIVASAMGVELIGMPPPSSGGAAVAQIIEFLDGYDLPLASAGTLGTHRTAEAF
FT                   KHAFAMRMNLGDPDSATPDMTAALNDMLSPTFNAELRSMTKDDRTLNVTAYGAKWNQLD
FT                   DSGTTHVSVVDKERNAVALTSTINTEFGSKLVSPSTGIVLNNEMDDFSSPGEVNHYGLA
FT                   PHEANFIAAGKRPLSSMSPTIVTRDGKLYAVAGASGGPRIITATAQLLLNVIARGMSPL
FT                   DAVNAPRLHHQLVPHVAFAEN"
     ggtgcggtcg ccgcggacga ggcgcgatgc agcgcgatcg gcgccgcggt actcgacgac        60
     ggaggccacg cggttgacgc ctcgattgcc accgcgctgt gcctgggggt cacgcatccg       120
     cactcgagcg gcgtgggcgg cggggcgttc atggtgatac gtctcgcgaa cggaacgaca       180
     gaggcgatag agttcaggga gtccgcgccc gcggcggcgt acagggatat gtacgtcgac       240
     ggaagcggcg cgaacggcgc gaacaggtct agcacgtttg gaggagccgc cgtcgcggtc       300
     ccagccgagc tcgcgggctt gcacctggcg tgggagcggc acgggcggct gccctggcgg       360
     cggctcgtgg agcccgcggc gttactcgcg aatgggttcg aggtggggaa ggatctggct       420
     cgggagattg cggatatggc cgaggacctc gcgaagtttc ccgtcacaaa ggaggttttc       480
     ctgaaagccg acgggtcgcc gcttttggag ggtgagactt gcgccaacac gcgactggcc       540
     gccacgctac gccgcgtcgc gaacgagggg ccgagtgtgc tccgaacggg tgagctggcg       600
     gatgcgctgg caaaggatat tagggacgcg ggcggcgtga tggagtcttc ggatctggct       660
     gcgtatcggc cgaggatttt tgagccgatt gtcgccagcg ccatgggggt ggagctcatc       720
     ggcatgcccc cgcccagctc gggcggcgcg gccgtcgcgc agatcatcga gttcttggac       780
     ggatacgacc tgccgttggc gtcggcgggc acgctgggga cgcacagaac agcggaggcg       840
     tttaagcacg cgtttgccat gcggatgaat ttgggtgatc cagactctgc cacgccggac       900
     atgacggccg ctctgaacga catgttgtcg ccgacgttca acgcggagct aagatccatg       960
     accaaggacg atcgaacgct taacgtgacg gcgtacgggg ctaaatggaa ccagctggac      1020
     gattcgggca cgacgcacgt gagtgtggtt gataaagaac gcaacgctgt ggcgctgact      1080
     tcgacgatca acaccgagtt tgggagcaag ctggtgtcac cgtcgaccgg gatcgtgctg      1140
     aacaatgaga tggacgattt ctccagcccg ggagaggtga accactatgg cctggcgccc      1200
     cacgaggcca acttcattgc cgcggggaag cggccgctgt cgtcaatgtc gccgaccatc      1260
     gtgacccgcg atgggaagct gtacgctgtg gcgggcgcat cgggcggacc caggatcatc      1320
     accgccacgg cgcagctgct gttgaacgta atcgcgcggg gcatgtcgcc gctggacgcg      1380
     gtgaacgccc cgaggcttca tcaccagctg gtgcctcacg tcgcattcgc agaaaat         1437
//

If you have problems or comments...

PBIL Back to PBIL home page