(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE431

MICSR_1.PE431        Location/Qualifiers
FT   CDS_pept        join(842783..842881,842993..843400)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637349"
FT                   /orf_name="MICPUN_57012"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61808.1"
FT                   /db_xref="UniParc:UPI000199AAD1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V8"
FT                   /transl_table=1
FT                   /translation="MTGWTPIELPPSNPKRTLDIVPKGLEAQEVCELMFKAIETNDCDT
FT                   YLSCCSHSTRAPRTVGSFGLTNWDQGREQWRKYKVTYRFLGESDPDDDDERPPGEWLKG
FT                   AERLVCRYQGQFGKVPGYDHGETVPRPAQAKQRPEQDVAVHLIREPLGGIWGAEREWRV
FT                   FKVEY"
     atgacgggct ggaccccaat agagttgccg ccgtccaatc caaaaaggac cctggacatc        60
     gtccctaagg gcctcgaggc ccaggaggtc tgcgagctga tgttcaaggc gatcgagaca       120
     aacgactgcg acacgtacct atcgtgctgc tcgcactcca cgcgcgcgcc gcggaccgtc       180
     ggcagcttcg gcctgacgaa ctgggaccaa ggcagggagc agtggcgcaa gtacaaggtc       240
     acgtaccgat ttctcggcga gtcggatccc gacgacgacg acgaaaggcc gccgggggag       300
     tggttgaaag gtgccgagcg actggtgtgc aggtaccagg ggcagttcgg gaaggtgccg       360
     ggatacgacc acggcgagac cgtgccgcgg cccgcgcagg cgaagcagcg gccggagcag       420
     gatgtcgcgg tccacctgat cagggaaccc ctcggaggaa tatggggcgc ggagagagag       480
     tggcgggtgt tcaaagtcga gtactga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page