(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE432

MICSR_1.PE432        Location/Qualifiers
FT   CDS_pept        complement(843511..845583)
FT                   /codon_start=1
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637350"
FT                   /orf_name="MICPUN_80126"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="ACO62236.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG737904"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000199AAD2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V9"
FT                   /transl_table=1
FT                   /translation="MITAHQADPTEDLRRERSQASFPSRELAALMAGGEAQLKLRERIA
FT                   DAVRADPVFSKKGKYFMERADLYRTTLEKYLALPRLATAIDPNDPITVGKIIRELIDEP
FT                   GGLDLHLGMFIPTIQGQGDEEQRKHWLPMCTKLQIIGTYAQTELGHGTYIRGLETTATY
FT                   DAEKEQFIIHSPTLTATKWWPGGMGKTSTHAVVMARLITHGRDRGPHAFVVQIRRNEDH
FT                   QTMPGVTAGDIGPKMGYNAVDNGFLRFDHVRVPRRAMLMRYSKVDPDGTFHPPPVAKAS
FT                   YGTMVFVRSDIVMNAALYMKKAVTIAMRYNLVRRQSNPGGEKASGGVGQKGLELQVIDY
FT                   QHSQRSLFPILARAFAFHCTSDFMRRMYFRYEKVSTRKGDFSALPELHATSSGLKAYCS
FT                   WATKDAIELCRLCCGGHGFMMLAGFGTTFGNYAPNATYEGDNNVLCLQTARYLLKVARA
FT                   VAKAAARGGDVRDAEEGAQGTSAYILEGGGGLEPGCQLGKSVGLRDTEAALGAFAHAAR
FT                   RQILAAASRAGTLGADAAMSRDMVAWIKAAKAHCAYVVLLNFVDAVAESKPRVSSATAA
FT                   VMDRLVSLHALATMDDNMGDFLEDGHVSADQAAAIRAEVAVLLAELRPDAAALVDSFAL
FT                   DDYFLNSALGSHDGDVYRRLYDEVQSAPFNASHVPPGYADLLHSRLIKGAGRSRL"
     atgatcaccg cgcaccaggc ggatcccacc gaggatctca ggcgcgagcg aagccaggca        60
     tccttcccct cacgcgagct cgccgcgctc atggctgggg gcgaggcgca gctcaagctt       120
     cgagagcgga tcgcggacgc cgtgcgagcg gacccggtgt tcagcaagaa gggaaagtac       180
     ttcatggaac gcgccgacct gtaccgcacc accctggaga agtacctcgc gctgcccagg       240
     ctcgccaccg ccatcgaccc gaacgatccc atcaccgtcg gcaagatcat ccgcgagctc       300
     attgacgaac ccggcggcct cgacctccac ctcggcatgt tcatacccac catccagggc       360
     cagggcgacg aagagcaacg gaaacactgg ctgcccatgt gcaccaagct gcaaatcatc       420
     ggaacctacg ctcagacgga gctcggtcac ggcacctaca ttcgcggtct cgagaccacg       480
     gcgacgtacg acgcggagaa ggagcagttt atcatccact cgcccacgct cacggcgacc       540
     aagtggtggc cgggcgggat gggaaagacg tccacgcacg cggtcgtcat ggcgcggctc       600
     atcacccacg gccgagatcg cggcccccac gcgttcgtcg tgcagattcg gcggaacgaa       660
     gatcaccaga cgatgccggg cgtcaccgcc ggtgatatcg gacccaagat gggatacaac       720
     gcggtggaca acgggttcct ccggttcgat cacgtccgcg tcccgaggcg cgcgatgctc       780
     atgcggtaca gcaaggttga cccagacggg acgttccacc cgccgcctgt cgccaaagcg       840
     agttacggga cgatggtgtt tgtccgcagc gacatcgtga tgaacgcggc gctgtacatg       900
     aaaaaggctg tgaccatcgc catgcggtac aacctggtgc gaaggcagtc gaacccgggg       960
     ggcgagaagg ccagcggcgg tgtgggacaa aaagggttgg agttgcaggt gattgactac      1020
     cagcactcgc agcggtcgtt gtttcccatc ctggccaggg ccttcgcgtt ccactgcacg      1080
     tccgacttta tgcggcgcat gtactttagg tacgaaaagg tgagcactcg aaagggcgat      1140
     ttcagcgctc ttcccgagct tcacgccacg tcatcggggc tcaaagcgta ctgctcgtgg      1200
     gccaccaaag acgcgatcga gctctgcagg ttatgctgcg gcgggcacgg gttcatgatg      1260
     ctcgcgggat tcgggacgac gtttggaaat tacgccccga acgccaccta cgagggcgac      1320
     aacaacgtcc tgtgccttca gacggcgagg tacctcctca aggttgcgag agccgtcgcg      1380
     aaggctgccg cgcgaggtgg ggacgtccgg gatgccgagg agggcgcgca gggcacgtcc      1440
     gcgtacatcc tcgagggcgg cgggggtttg gagcccgggt gccagctggg caaatccgtc      1500
     gggctgcggg acacggaggc ggcccttggg gcctttgcgc acgccgcccg gcggcagatc      1560
     ctcgccgcgg cgtcgcgcgc gggaaccctc ggcgccgatg cggccatgtc ccgcgacatg      1620
     gtggcctgga tcaaggcggc gaaggcgcac tgcgcgtacg tggtgctgct gaatttcgtg      1680
     gacgcggtgg cggaatccaa gccgagggtg agctcggcga cggcggcggt gatggatcgg      1740
     ctcgtgtcgc tccacgcgct ggccacgatg gacgacaaca tgggggattt cctggaggac      1800
     ggccacgtgt cggcggacca ggcggcggcg atccgcgcgg aggtggcggt gctcctcgca      1860
     gagctgagac ccgacgcggc ggcgctcgtg gactccttcg cgctggacga ttacttcctc      1920
     aactcggcgt tgggctcgca cgacggagac gtttacagga ggctgtacga cgaggttcag      1980
     tcggcgccgt tcaacgcgtc gcacgtgccg ccggggtacg cggacttgct gcactcgcgg      2040
     ctcatcaagg gcgccgggcg aagtaggctg tga                                   2073
//

If you have problems or comments...

PBIL Back to PBIL home page