(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE433

MICSR_1.PE433        Location/Qualifiers
FT   CDS_pept        845975..847522
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637351"
FT                   /orf_name="MICPUN_57014"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61809.1"
FT                   /db_xref="UniParc:UPI000199AAD3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W0"
FT                   /transl_table=1
FT                   /translation="MGAESKGILKPSRFSAHVDEPAAHADEGDATPSATQTTHYKEFHS
FT                   RVADVFANLGPGICGSGSTGGASDPKGSHQSPAEAVWMPANTTVTRRGARDDYSDDDDD
FT                   DEDEDGRIGRPKRNGNDDSSDDSRDDPSDEDDEEDRPTFDHTASNAEVSEVRRQRQKAR
FT                   WAEDLDCLESDEEGDDDQKKMAKLGRSVGRCSALNDEEEFDCYDTLAMTGMNRRQPMDR
FT                   NGEGGIDVARIRRLVEGDDDEFEEVDKEDVGFTKVLASNEYERRILAREGKDAPDEDED
FT                   EDEDEDEDEDTPDEAAAAAAGVGAATVDPVADGAAAAGRRKRGGFGGAYVPPNKRAKGE
FT                   PGAAPTRGVAWDDSVPEVTRPRFGGSRGRGGGRGRGRGVPDHVKNPHKYTCYTLDEPLT
FT                   VGGGGGVGDGFKEMEAARRAASAAAAARDATPNERSLPAAPTEKPVFQLSAAAAARRDA
FT                   RRGEKKKAGSATVAGVKIDFAHDDEDDEGGAEDGNRSGLGGSKKRARNFRKKAAEDD"
     atgggcgccg agtcgaaggg tatcctgaag ccgagtcgct tctccgcgca tgtggatgaa        60
     ccagccgcgc acgcggatga aggggacgcg accccgtcgg ctacgcagac gacgcactac       120
     aaggagttcc acagcagagt ggcggatgtc ttcgccaacc tgggaccggg gatctgcggg       180
     agcggctcga caggcggagc ttccgacccg aagggctcac atcagtcccc cgctgaagcc       240
     gtttggatgc cagcaaacac caccgtgacg cgcagaggcg ccagagacga ctacagcgac       300
     gacgacgacg atgatgagga cgaggacggg cgcatcgggc gccccaagcg aaacgggaac       360
     gacgactctt ccgacgacag tcgggacgat ccctccgatg aggacgacga agaagaccga       420
     cccacgttcg atcacaccgc gtccaacgcg gaggtcagcg aggtccgccg tcagcggcaa       480
     aaagctcgct gggccgagga cctggactgc ctggagagcg acgaggaggg cgacgacgac       540
     cagaagaaga tggccaagct cgggcggagc gtcggccggt gctccgcgct caacgacgag       600
     gaggagttcg actgctacga cacgctcgcg atgacgggga tgaatcgaag gcagccgatg       660
     gatcgcaacg gcgagggcgg gatcgacgtg gcgaggatac ggaggctggt cgaaggcgac       720
     gacgacgagt tcgaggaggt cgacaaggag gacgtggggt tcacgaaagt tctcgcgtca       780
     aacgaatacg aacgaaggat actggcgagg gagggcaagg acgcacccga cgaggacgag       840
     gacgaggacg aggacgagga cgaggacgag gacacacccg acgaggccgc agccgccgct       900
     gccggagtcg gagcggcgac ggtcgatcca gtcgcggatg gcgcggcggc ggcggggagg       960
     cgtaagcggg gcgggttcgg cggggcgtac gtgcctccga ataaaagggc gaagggggag      1020
     cccggggcgg cgccaacccg cggcgtcgct tgggacgatt ccgtgcccga ggtgacaagg      1080
     cccaggtttg gcgggtctcg cggtcgcggt gggggaagag gacgcggcag aggcgtcccc      1140
     gatcacgtca agaaccccca caaatatacg tgctacacgc tcgacgaacc tctgacagtc      1200
     ggcgggggcg gcggtgtcgg ggacgggttt aaggagatgg aggctgcccg ccgcgctgct      1260
     tcagcggctg cagccgcgag ggatgcgacg cctaacgaac gatcgttacc cgcggccccg      1320
     acggagaagc ctgttttcca gctgtcggct gcagccgcgg cgagacggga cgccaggcga      1380
     ggggagaaga agaaagccgg gtctgcgact gtcgcgggcg tgaagataga ctttgcgcac      1440
     gacgatgagg acgatgaggg cggcgcggag gatgggaatc gttcggggct cggcgggagt      1500
     aagaagcgcg cgcgtaactt caggaagaaa gccgctgagg acgactga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page