(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE434

MICSR_1.PE434        Location/Qualifiers
FT   CDS_pept        join(847817..848164,848264..848350)
FT                   /codon_start=1
FT                   /gene_family="HOG000030633" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637352"
FT                   /orf_name="MICPUN_57015"
FT                   /product="Twin arginine targeting family "
FT                   /function="protein transporter activity"
FT                   /biological_process="protein secretion"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ACO61810.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR003998"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniParc:UPI000199AAD4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W1"
FT                   /transl_table=1
FT                   /translation="MASTTASLVVRPTHAVRTRARSPASSAAPKSAAMSGLSAPAPAFL
FT                   GAKPAQLSAGITAGRSGAGTRSVATMGLFGLGLPELVVIGGVAAVLFGPSKLPELGKSL
FT                   GKTVKSFQAAANEFQDELKSDKEGEEQPPKQIEEGEKKSD"
     atggcctcaa ccaccgcttc cctcgtggtc cgccccaccc acgccgtgag gacccgcgcc        60
     aggtccccag catcgtccgc agcgcccaag tccgcggcca tgtccggtct gagtgctccg       120
     gcgcccgcgt tcctcggcgc taagcccgcg cagctttctg ccggcatcac cgcgggccga       180
     tccggtgcgg gcacccgcag cgttgccaca atgggcctct tcggccttgg tctccccgag       240
     cttgtggtca ttggcggcgt ggcggcggtg ctcttcgggc cctccaagct tccggagctc       300
     ggcaagagcc tcggcaagac ggtgaagagc ttccaggcgg cggcgaacga gttccaggat       360
     gagctcaagt cggataagga gggcgaggag cagcccccca agcagatcga ggagggagag       420
     aagaagtctg actaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page