(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE435

MICSR_1.PE435        Location/Qualifiers
FT   CDS_pept        complement(848405..850036)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637353"
FT                   /orf_name="MICPUN_57016"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62237.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AAD5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W2"
FT                   /transl_table=1
FT                   /translation="MGIFDEVFGRKIEGDGGGLFSDKYKAERDVIHDPLPASAYVDVLK
FT                   KNDELLEQLAKSGKGMAREEFSDSDGDSDGYSDKDDSSDSDSDSERPAKKPKKKERSKY
FT                   EEMDEAFAEANAMMAEGEPDKRKKSAAAAAEDTSDDESGSEEDDESDSDAGSDDEDDEG
FT                   AGASSDSDSLTDVEAERAARKAARDEAKAKKAAAKQAKEQQPGEEHRPQDDALPRTVFV
FT                   GNLPVTIKPKKLKTLFSEFGAVDSVRLRNVPVDPEGKMPRGGKVITGKLVENRKSTNAY
FT                   VVFKEEKSVEAACKGMNMREVDGRHVRVDRAVAPSAKANETIAKEKGANAGGEVAYDHT
FT                   RSLFLGNLPYDVDEEDVIRLFHRSKEYPELNGAVEAVRVVRDRKTNLGKGIAFVLFRKG
FT                   SDARTGLLLDGTKMGEREVRVTRASKNREALKAQAEKSKKRKADKEAKKEPQGAARRLG
FT                   LDKAPDAKGSAAAWEGSRSRPGGKRQKIAFGGYDAAIERGKDGKKGAGGKGGGKPAAKG
FT                   ARTGKRPAVAARKAKAKAQAAAGKKK"
     atgggcatct tcgacgaggt attcggtcga aagatcgagg gcgatggcgg cgggcttttt        60
     agcgacaagt acaaggccga gcgcgacgtc atccacgacc cgcttcccgc cagcgcgtac       120
     gtcgacgtcc tgaagaagaa cgacgagttg ctcgagcagt tggccaagag cggaaagggg       180
     atggcgcggg aggagttcag cgacagcgac ggcgattccg acgggtactc cgacaaggac       240
     gacagctccg acagcgactc tgacagcgag cggcccgcta agaaacccaa gaagaaggaa       300
     cggagcaagt acgaggagat ggacgaagcc ttcgcggagg ccaacgcgat gatggcggag       360
     ggcgaacccg acaagcgcaa gaaatcggcg gcggcggcgg cggaggacac gagtgacgac       420
     gaatcggggt ccgaagagga cgacgagtcc gattccgatg cgggttcgga cgatgaggac       480
     gatgagggtg caggtgcgag ctccgacagc gattccctca ccgatgtcga ggctgagcgc       540
     gccgcgagga aggcggccag ggatgaggcc aaggcgaaaa aggcagcggc gaagcaggcc       600
     aaggagcaac aacccggaga ggagcacagg ccgcaggacg acgccctacc ccgcacagtc       660
     ttcgtcggca acctcccggt gaccatcaag ccgaagaaac tcaagacgct gttctccgag       720
     ttcggcgccg tggacagcgt gcgactgcgt aacgtcccag tcgaccccga gggcaagatg       780
     ccgaggggcg ggaaagtaat caccgggaag ctcgtcgaga atcgcaagtc cacaaacgcc       840
     tacgtcgtct tcaaggagga gaagtccgtg gaagccgcgt gcaagggtat gaacatgcgg       900
     gaggttgatg ggcgccacgt ccgcgtcgat cgcgccgtcg cgccgtccgc caaggctaac       960
     gaaacgatcg caaaggagaa gggcgcaaac gcggggggag aagtcgcgta cgaccacact      1020
     cgctccctct tcctgggtaa ccttccttac gacgtcgacg aggaggacgt catccggttg      1080
     ttccacagga gcaaggagta ccccgagctc aatggcgctg ttgaagccgt tcgggtggtg      1140
     cgggatcgca agacaaacct gggcaagggc atcgcgtttg tgctcttccg caagggttcg      1200
     gatgcgagga cggggctgct cttggacgga accaagatgg gtgaacggga ggtgagggtc      1260
     actcgcgctt ctaagaacag ggaggcgctc aaggcccagg cggagaagag caagaagcgc      1320
     aaggcggata aggaggccaa gaaggagccc cagggtgccg cgcgcaggct ggggctggac      1380
     aaggcgccgg atgcaaaggg atccgccgcc gcgtgggagg gatcgaggtc gaggcccggc      1440
     gggaagaggc agaagatcgc cttcggtggt tacgacgccg ccatcgagcg tgggaaggat      1500
     ggaaagaagg gggcgggggg taagggtgga gggaagcccg cggcgaaggg tgcgaggacg      1560
     ggtaagcgac cggcggtggc ggcgaggaaa gcaaaggcca aagcccaggc tgctgcaggc      1620
     aagaagaagt ga                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page