(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE436

MICSR_1.PE436        Location/Qualifiers
FT   CDS_pept        join(852218..852403,852500..>853299)
FT                   /codon_start=1
FT                   /gene_family="HOG000197973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637354"
FT                   /orf_name="MICPUN_80108"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61811.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG714073"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199AAD6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W3"
FT                   /transl_table=1
FT                   /translation="MPGGLLHLDNSEHILSIGYVHRHRPFEEEYDLGEAIGTGGFAVVR
FT                   KAVHRATGVTYAVKTLRKPRKLVAMSLEEVMNELIMMQQLSEHPSIITIKEFFTEGGAD
FT                   YDHIATKPTTGLDEEEDGIVHVVMELLEGQELVDAITDVGAYDEGQSQIVMSSMLDAIA
FT                   FMHARGVVHRDLKLENLCLAKPNDLNSVTLLDFGLAKALTAREKEENVCGTLAYVAPEA
FT                   LVAGVYGQGVDVWALGVAMHVLLTGAWPFDDDDEDELIDQIVECDLDFDEGEEWQAISP
FT                   QAKDLLGGLLEPNPKRRLGAAQALEHAWFTGQKNNTSERLHHVHARL"
     atgcccggcg gtttgctgca tctggacaac agcgagcaca tcctgtccat cggctacgtc        60
     cacaggcaca ggccttttga agaggaatac gacttgggtg aggccatcgg caccggtggt       120
     tttgcagtgg tgcgcaaggc tgtgcacagg gccaccggtg tgacctacgc ggttaagacg       180
     ctcaggaagc ctcgcaagct ggtggccatg tccctggagg aagtcatgaa cgagctcatt       240
     atgatgcaac agctctcgga gcacccatcc atcatcacca tcaaagagtt cttcaccgag       300
     gggggcgcgg attacgacca catcgccacc aaacccacca ccggtctcga cgaggaggag       360
     gatggtatcg tccatgtggt gatggaactt ctcgagggtc aggagcttgt ggacgcgatc       420
     actgacgtgg gcgcctacga cgaggggcaa tcgcagatcg tcatgtcaag catgctcgat       480
     gccatcgctt tcatgcacgc gaggggtgtc gtgcacaggg atttgaagct cgagaacctg       540
     tgcctggcca aaccaaacga cctcaactcg gtgacgctcc tcgattttgg ccttgctaag       600
     gcgctcaccg cgcgtgaaaa agaggagaac gtctgcggca cgctcgcata cgtcgcaccc       660
     gaggcattag tcgcgggcgt atacggtcag ggtgtggacg tgtgggcgct gggcgtcgcg       720
     atgcacgtgc tcttgaccgg cgcgtggccg tttgacgacg acgacgagga tgagctcatc       780
     gaccaaattg tggagtgcga cctcgacttt gatgaaggcg aagaatggca ggctatttct       840
     ccacaggcga aggacctgct cgggggttta ttggagccga acccaaagcg aaggctcggt       900
     gccgcgcagg cgctcgaaca tgcttggttc accggtcaga agaataacac gtccgagcgt       960
     ttgcaccacg tacacgcgag gcttga                                            986
//

If you have problems or comments...

PBIL Back to PBIL home page