(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE437

MICSR_1.PE437        Location/Qualifiers
FT   CDS_pept        855288..856454
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637355"
FT                   /orf_name="MICPUN_52253"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61812.1"
FT                   /db_xref="UniParc:UPI000199AAD7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W4"
FT                   /transl_table=1
FT                   /translation="MNRDEKQSALPLPTSSNHIPALRALAESDALSPSLLILSDAARTL
FT                   SRGAFLYLNLASHSLVHLEIRNCEWLESLDFVSELPSLRCLSLRGCVALPSHSLEALAR
FT                   PPKNDDAHAPPRRRGRRRPELAGNRAGARDPPNLVSLDLSGCAAVDDAAGPHLARLPRS
FT                   MRSLDLSTCAVGNLLLDYLTYRGRLTRWRRDRRGIGESENGTSEDGTSDDDGCTATDLR
FT                   LRGTRVSDAGLGHLKTLGPDVALLDLSECRGVSAGAIAELASVLGMSASTSRPGLLVAP
FT                   GTGEGREMCACGSGRESCCELAEEGWRAFLCAVREEEIREEEIREEEIREESQRVAALA
FT                   ASERDESDAVEDDGNIPMFPIGAPLSHSHPSGGESPPHQYRRVSYLID"
     atgaatcgag atgagaagca aagtgcgctt ccgctcccca cctcgtcgaa ccacattccc        60
     gcgttgaggg cgctcgccga gtctgacgcg ctctcgccaa gcttactgat cctctccgac       120
     gccgcgagga ctctgtctcg cggggcgttc ctctacctca atctcgcgtc tcactcgctg       180
     gtgcacctgg agattcgcaa ctgcgaatgg ctcgaaagtt tggacttcgt gtccgagctt       240
     ccgtcgttgc gatgcctgtc cctgcggggg tgcgtcgcgc tgccgtccca ctccctcgaa       300
     gctctcgcgc gtccgccgaa gaacgacgac gctcacgcgc ccccgcgacg gcgcggtcga       360
     cgtcgaccgg agctcgccgg aaaccgcgcc ggagctcgcg atcccccgaa cctcgtgtcg       420
     ctcgacctgt cgggatgcgc cgccgtggac gacgccgcgg gtcctcacct cgcgcgtctg       480
     ccgagatcga tgaggtcgct agacctctcg acgtgcgccg tgggcaacct gctcctggac       540
     tacctgacgt accgaggcag gctgacgcgg tggaggcgcg accggcgggg aatcggagag       600
     tcggagaatg ggacgagcga ggacgggacg agcgacgacg acgggtgcac ggcgacggac       660
     cttcgtctga ggggcacgcg ggtgagcgac gcgggtttgg gacacctcaa aaccctcggc       720
     ccggacgtgg cgctgctgga cctctccgag tgccgggggg tatcggcggg ggcgatcgcg       780
     gaactcgcga gtgttctcgg gatgtccgcg tcgacctcgc gaccggggct gctggtcgcg       840
     ccggggacgg gtgaaggccg cgagatgtgc gcgtgcggtt cggggcgcga atcttgctgc       900
     gagcttgccg aggagggttg gcgcgcgttc ctgtgcgcgg tgagggagga ggagatccgg       960
     gaggaagaga ttcgggagga ggagattcgg gaggagagcc agagggtcgc ggcgctcgcg      1020
     gcgtcggagc gggacgagtc ggacgccgtc gaggacgacg ggaatattcc catgttcccc      1080
     atcggcgccc cgttgtcgca ctcgcacccg agcggtggcg agagtccgcc gcaccagtac      1140
     cgacgcgtgt catacctcat agactaa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page