(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE438

MICSR_1.PE438        Location/Qualifiers
FT   CDS_pept        join(complement(857318..859397),complement(856504..857033))
FT                   /codon_start=1
FT                   /gene_family="HOG000100027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637356"
FT                   /orf_name="MICPUN_57020"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62238.1"
FT                   /db_xref="HOGENOM:HBG608405"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199AB45"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W5"
FT                   /transl_table=1
FT                   /translation="MSSRQVQLNQELARKTLAADVLAIVRDSVDEFNLVNCGTALQRLA
FT                   KCPDTHRLLSPTSSALPGVPRVLQEQFARLLDAAARLVSKDPRHVESRQLASMLWACGK
FT                   LELGHRAADLVEGIETAAIMHASKFNPQELANAIWGAAKLGLDPSRSELVRAVADAIAV
FT                   SLPRASAAPGGPQRNPKGAGPGGWRANAPREWTPQGISNVAMSLAKLDADVTHGEGVST
FT                   TGGGFKYGRVFGEVCAAAKARAEDFNPQEIANILHALAKLTAGDGDGDGGGRTIVGPVE
FT                   RTARDATEALASRITRRWIEAQRLEPQHVANMSWACAKMGAAGGDDLAGALATAAATLA
FT                   PRMNTQELSMCAWSAAAFGSGRWPADCAETVARAFGNRAGEATPRQLAKAAMAYAKLGT
FT                   LHPRLMDAVANAVLALEQPFASALNPQDVANLAWSFSKLGFKKKRLFDAISAAFVAHLG
FT                   EDEARFSSQQLTMIVCAFGLLDFKDESMLNAAMGAMSKERVAEFNPRDLTNTSWALAAL
FT                   GVNAEAKPDLVERIGRTARKRLDDFNSQELLKFLGAFERLGGKDSKLAKAVSKQRTLSY
FT                   EFPALSTHAESSFVKLSSKTPTSYQGTDRVRVDDSCGGWGRGNTGVALWEGSFVLAEWL
FT                   SRQSTPTGSDEMAEVMRGAWGPNESGGWRGMTGVELGAGLGLPSIVASKLGLEMVATDG
FT                   DDDVLELLSQNIETNTSPEAKARVSRLVWGCDEPLEHLGLSEPPKLILASDVVYGNDPQ
FT                   KWKLLVKTMCDLSGPSTLVVIGNVQRYPVHHPMAETKFFSEATARDFERTEVPVTSLHP
FT                   DFRRTGGGACVIHLFRRRPESLKRSRSDSDVSERKVKKSKKEKKGKKEKKSSKKERK"
     atgagttcga ggcaggtcca gctgaaccag gagctggccc ggaagacact tgcggccgat        60
     gtcctcgcga tcgtgagaga ctccgtcgat gagttcaacc tcgtaaactg cgggaccgcg       120
     ctccagaggc tcgccaagtg ccccgacacc caccgcctgc tctcgccgac atcgtccgcc       180
     ctcccgggcg ttcccagggt tctccaggag cagttcgcgc gattgctcga cgccgccgcg       240
     aggctggtga gcaaagaccc gcgccacgtg gagtcaaggc agctcgcgag catgctgtgg       300
     gcgtgcggca agctcgagct cggccaccgc gcggccgacc tcgtcgaggg catcgagaca       360
     gccgcgatca tgcacgcgtc caagttcaac ccgcaggagc tcgccaacgc catctggggc       420
     gccgcgaagc tcgggctgga cccgtcgcga tccgagctcg tgcgcgcggt cgccgacgcc       480
     atcgcggtct ccctgcccag ggcttcggcg gcgcccggcg ggcctcagcg taaccccaag       540
     ggggccggac cgggcggctg gcgcgcgaac gcgccgcggg agtggacgcc gcaggggatc       600
     agcaacgtgg cgatgtccct cgcgaagctc gacgcggacg tgacgcacgg cgaaggcgtg       660
     tccacgaccg ggggcgggtt caagtacggg cgggtgttcg gggaggtgtg cgccgcggcg       720
     aaggcccggg ccgaggactt caacccccag gagattgcca acattctcca cgcgctcgcg       780
     aagctcaccg cgggggacgg cgacggggac ggcggcggga ggaccatcgt cggtcccgtc       840
     gagcgcaccg cgcgcgacgc gacggaggct ttggcgtcga ggatcacgag acggtggatc       900
     gaggcgcagc ggctggagcc ccaacacgtg gcgaacatgt cgtgggcgtg cgccaagatg       960
     ggcgccgcgg gtggcgatga cctggcgggc gcgttggcga ccgccgccgc gacactcgcg      1020
     ccgcgcatga acacccagga gctttccatg tgcgcgtggt ccgcggcggc gttcgggagc      1080
     gggcgctggc ccgcggattg cgcggagacg gtggcgagag cctttggcaa tcgcgcgggc      1140
     gaggcgacgc cgcggcagct tgcgaaggcg gcgatggcgt acgcgaagct gggcacgctc      1200
     cacccgagac tgatggacgc ggtggcgaat gccgtgctcg ccctggagca gcccttcgct      1260
     tcggcgctca acccccaaga cgtggccaac ctcgcgtggt cattttcaaa gctcgggttc      1320
     aagaagaagc ggctgttcga cgccatctcc gccgcatttg tcgcccacct cggcgaggac      1380
     gaggcacgct tttcgtccca gcaactcacg atgattgtgt gtgcgttcgg tttgctggat      1440
     ttcaaggatg agagtatgct gaacgcggct atgggcgcaa tgagcaagga acgggtagcg      1500
     gaattcaacc ctcgggatct gactaacacc tcatgggcgt tagctgcgct cggtgtgaac      1560
     gctgaggcta agccggacct ggtggagcgc ataggccgaa ccgcgcggaa acgtctcgat      1620
     gattttaact cgcaggagtt gctcaagttt ctcggcgcct tcgagaggct cggagggaaa      1680
     gactcaaagc tcgcgaaggc agtctccaag cagaggacac tctcgtacga gttcccggct      1740
     ctgtccacac acgccgagag ttcatttgtg aaactcagct ccaagacccc gacgagctat      1800
     cagggcaccg accgcgtgcg cgtggacgat agctgcgggg gctgggggcg gggtaacacc      1860
     ggggtagcgc tttgggaagg aagctttgtg ctggcggagt ggctgtcccg gcagagcacg      1920
     ccgacgggat ccgatgagat ggccgaagtt atgcgcggtg cgtggggacc gaacgagagc      1980
     gggggttggc gtggtatgac cggcgtggag ctcggagccg ggcttggcct cccatcgatc      2040
     gtcgcgtcta agctcgggtt ggaaatggtg gccacggacg gcgacgatga cgttctcgag      2100
     ctcctctcac aaaacataga gacaaacacc tcccctgagg ccaaggcgag ggtgtcccgc      2160
     ctggtttggg gatgtgacga gcctcttgaa cacctcggcc tctccgagcc ccccaagctc      2220
     atcctcgcat ccgacgtcgt gtacgggaac gacccccaaa aatggaagct cctggtaaag      2280
     accatgtgcg acctcagcgg gccgtcgacg ctggtggtca taggcaacgt gcagaggtat      2340
     ccggtgcatc acccgatggc ggagactaaa tttttcagcg aggcgaccgc gcgggatttc      2400
     gagcggacag aggtgccggt gacaagtttg cacccagact ttagaaggac gggcggtggc      2460
     gcgtgcgtga ttcacctgtt cagacgacgc ccggagtcgc tgaagcgctc gcggtcggat      2520
     agcgatgtca gcgagaggaa ggttaagaag tccaagaagg agaagaaggg gaagaaggag      2580
     aagaagtctt ccaagaagga gaggaagtaa                                       2610
//

If you have problems or comments...

PBIL Back to PBIL home page