(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE439

MICSR_1.PE439        Location/Qualifiers
FT   CDS_pept        complement(859804..861807)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637357"
FT                   /orf_name="MICPUN_57021"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62239.1"
FT                   /db_xref="HOGENOM:HBG560211"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniParc:UPI000199AB46"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W6"
FT                   /transl_table=1
FT                   /translation="MAQQQPPPLILFLAGAAAGALIAANGVLSAVRKRAGRSRSRDDGR
FT                   RVRVGLEVAKDDNWKIFRGKKVGVVSNPTGVLPTTLEHTVDVMHASVGTVDIRAVFGPE
FT                   QGFRGVGQNSNPYGSYDSDKENGSDGSFVDQRTGLPVYDTYLKKGPELTAILERSGVDV
FT                   VAFDIQDVGARYYAYVWTLYDVMVAAASAKKPISVVVLDRPNPLGGEVLEGPVDIAVGC
FT                   ESLVGRKPIPVRHGMTVGELAWFLNKKYVAADPDNGSRKSVKLSVVAMRGYRRRMTWEE
FT                   TGLPWVPPSPNMPTPRTALAYVGGALLEGTNCCEGKGTTAPFELVGATWADGRLADFLM
FT                   RRTPASAARSVAPLDASNESPQPRSEEEETEPAPSRRGRSSVKRGLNYRPNYAESSPGN
FT                   SPRKNGARPSPGTPRGGIGKKPRGGKSAKGKGRKKSKSRLSRPPSGKMIRIREGAPVDG
FT                   PAAKYREAYFTPTSGALQGRIVSGVQVYPRGIENALFREGVEILLALRRCYPGEFAWRE
FT                   QATVRARVENARWRAENSAVLRSPAKSTYSNYSRKGGYYPDERSSDDGYSSEDDRGWRG
FT                   DDGEVPWSPESARRPGRRPGLPPRSPVPPAPPPPARWDPKKTPFIDMLTGSAALREAVD
FT                   AADDEKVEGVIAEWESQLEKFAEVRRGFLLYD"
     atggcgcagc aacagcctcc gcctctgatc ttgttcctgg ccggcgccgc ggctggcgcg        60
     ctgatcgccg ccaatggtgt gctctcggcc gtccgcaagc gtgcgggaag gtccagatca       120
     cgcgacgacg gaaggcgcgt tcgcgtcggc ctggaggttg ccaaggacga caactggaaa       180
     atcttcagag gcaagaaggt tggcgtcgtg agcaacccca cgggcgtcct accgaccacc       240
     ctggagcaca cggtcgacgt catgcacgca tctgtcggta ccgtggacat ccgcgcggtc       300
     ttcggccccg agcagggctt cagaggcgtc ggccagaact ccaacccgta cggcagctac       360
     gactccgaca aggagaacgg atccgacggg tccttcgtcg accagcgcac ggggctcccg       420
     gtgtacgaca cgtacctgaa gaagggcccc gagctcaccg cgatactgga gcgatccggc       480
     gtggacgtcg tcgccttcga catccaggac gtgggcgcca gatactacgc gtacgtctgg       540
     acgctctacg acgtcatggt cgccgcggct tcggctaaga agccgatatc agtcgtggtg       600
     ctggatcgac ccaacccgct gggcggcgag gtgctggagg ggccggtgga catcgcggta       660
     gggtgcgaga gcctcgtggg tcgcaagccc atcccggtgc ggcacggcat gacggtgggc       720
     gagctggcgt ggttcctcaa caaaaagtac gtcgccgccg atcctgacaa cggctctcgc       780
     aaatccgtga agctcagcgt cgtggccatg cgcggttaca ggcgacgcat gacctgggag       840
     gagaccggac ttccgtgggt acccccgtcg cccaacatgc ccaccccgcg aaccgcactg       900
     gcgtacgtgg gaggcgcgct tctggagggt accaactgct gcgaggggaa agggacaacc       960
     gcgcctttcg agctggtggg cgcgacgtgg gcggatgggc gactcgcgga ctttctcatg      1020
     agacgaacac ccgcgtcggc ggctcggtcc gtcgcgccac tggacgcttc gaacgagtca      1080
     ccgcagccga ggtccgagga ggaggagacg gagccggccc cgagccgccg gggccgaagc      1140
     tccgtgaagc gggggctcaa ctacaggccc aattacgcgg agtcttcccc ggggaacagc      1200
     ccgcgcaaga acggcgccag gccctcgccc ggcaccccgc gcggcggcat cggcaagaag      1260
     ccccgcggcg ggaagagcgc caaggggaaa gggaggaaga agagcaagag cagactgagc      1320
     cgaccgccga gcgggaaaat gattcgaatt cgcgaaggag cccccgtcga tggacccgcg      1380
     gcgaagtacc gcgaggcgta tttcacccca acctcgggcg cgctgcaggg acgaatcgtg      1440
     tccggcgtgc aggtgtaccc gcgcggaatc gagaacgccc tgttcaggga gggagtcgaa      1500
     attctgttgg ccctgaggcg gtgctacccc ggggagtttg cgtggcggga gcaggcgacg      1560
     gtgcgggcca gggtcgagaa cgcgagatgg cgcgccgaga actcggcggt gctgcgctcc      1620
     cccgccaaat ccacctactc caactactcc aggaagggag gatactaccc ggatgaacgc      1680
     tcctcggacg acgggtacag ctccgaggac gatcgcggct ggcgcggcga cgacggcgag      1740
     gttccctgga gccccgagag cgctcgaagg cccggtcgaa ggcccgggtt gcccccgcgg      1800
     tcgcccgttc ccccggcgcc cccgccgccc gcgcgatggg acccgaagaa gaccccgttc      1860
     atcgacatgc tcacgggcag cgccgcgctg agggaggctg tggacgcggc ggatgacgag      1920
     aaggtcgagg gcgttatcgc cgagtgggag tcgcaactgg agaagttcgc ggaagtcagg      1980
     cgagggttcc tcctttacga ttaa                                             2004
//

If you have problems or comments...

PBIL Back to PBIL home page