(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE440

MICSR_1.PE440        Location/Qualifiers
FT   CDS_pept        join(862127..862165,862282..862653,862930..867594)
FT                   /codon_start=1
FT                   /gene_family="HOG000188877" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637358"
FT                   /orf_name="MICPUN_105289"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin coat of coated pit "
FT                   /cellular_component="clathrin coat of trans-Golgi network
FT                   vesicle"
FT                   /protein_id="ACO61813.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030130"
FT                   /db_xref="GO:0030132"
FT                   /db_xref="HOGENOM:HBG317411"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001473"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012331"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="InterPro:IPR022365"
FT                   /db_xref="UniParc:UPI000199AB47"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W7"
FT                   /transl_table=1
FT                   /translation="MAAPPVTVKEVVSLTSSGINPQNISFTNLTMESEKFICVRETGAA
FT                   NSVVIVDMAQPMTPMKRPITADSALMNPAAKVIALKATVAGTAQDHLQIFNIDTKSKMK
FT                   SHQMPESVVYWRWISPSLMGIVTNTAVYHWSMEGDSEPQKMFDRTGNLNGCQIIAYRAS
FT                   QDMKWFSVVGIAAGDPSRPGLVKGKMQLFSKELGRSQELDAHACAFSTHQVTGNSVKSQ
FT                   VIAFAQKTVMPDGNVASKLHVIELGAQAGQTPFQKRQAELFFPPEFMDDFPVNMSISEK
FT                   YGVIYVVTKMGLLFVYDLETATAIYRNKVSNDPVFLACDSPSTGGVYAVNRRGQVLLLN
FT                   LNEPAVVPFISGQLNNVSLALQVAVRGGLPGAESLVKPKFEQLFAAGDIKGAAECAADS
FT                   PKGILRNPETIARFKAIPAQPGAAPPLLQYFGICLQRGTLNKVEGVELARLVLAQNKKQ
FT                   LLDTWMAEDKIECSEELGDLLQSVDADMALRVYIKAKANTKVVAALAARGEFEKMGKYC
FT                   EMADYKPDYSYLLQSTLMSNPQGAVTIALQVSKMNPPPLDYNTVADLFLQRNMIREATS
FT                   FLLDVLKEDREDQAAMQTKVLEINLVTFPNVADAILGQGKLTHYDRPRIAQLCEKAGLY
FT                   MRALEHYTEVSDLKRCCVNTHSIDPQALLEWFGTLSREWALECIKELLVSNPRQNLQII
FT                   VNVCKEYTEQIGADAILKLLEEHNSSEGMFFYLGALVATSTEPDHHQKYIEAAAKTGQI
FT                   KEVERITRESEHYDPEKAKVFLMEAKLPDARPLINVCDRFDMVDDLTTFLYQNKMLRYI
FT                   EGYVQKVNPSNTPVVVGALLDLECDEDFVQNLILSVRSLLPVGPLVEEVSKRNRLKMLT
FT                   PFLENLVAEGSTNADVHNALGMILIDSNTNPEHFLTTNEYYDSKVVGKYCEKRDPNLAC
FT                   VAYKRGNCDLELVEVTNKNSLFKLQSRYVVERMDADLWEHVLAEDNPHRRQLIDQVVST
FT                   ALPESKNPEQVSVTVKAFMTAEMPQELIELLEKIVIQNSAFSNNPNLQNLLILTAIKAD
FT                   TTRVMDYINRLDAFNGPEVGEIAVGNELYEEAFAIFKKFDLHVDAMKVLLENLENLERG
FT                   EEYANKVDLPEVWSQLAKAYLSQDLVSAAVAAYIKAKYTDDYLAVIDVAKRADDFDSMV
FT                   KYLAMVRKKVKEPKVDSELCYAYAKTDKLAELEEFITQPNAAKLDNVGDRCFDEGLYEA
FT                   AKVLFTTCSNWGRLASTLVKLHKFSEAVDAARKANNTRTWKEICFACVDEGEFRLAQLC
FT                   ALNIIVNADELEEISEYYQVRGRYEELLSLMEAGVGLERAHMGIFTELGILYAKFKPEK
FT                   LMEHLKLFSTRINIPKLIRACEEMHAWKELSFLYIAYDEYDNAAGVMMAHPDAWEHVGF
FT                   KDVCVKVANLEIYYKALEFYLVSHPTQLNDLLTVLTPRIDHSRVVALMRQANHLPLIKP
FT                   YLQAVQNTNMVAVNDAVNELCLEEEDFESLRTSIDTYDNFDQMSLANKCEKHELLEFRR
FT                   IAGFLYQKNAKWTKSVELSKKDGLYKDAMEAAAQSGDKDIAGDLLQFFIEQENKECFAA
FT                   MLYNCYDLLKPDEVLEIAWMKGLMEYAMPYMIQVMKDYTNKVDVLVEDKKDRNKEKADQ
FT                   EKEKVEQQMNQNMYAQLLPAALPAPGMETTGGMNNPGMYGQMGGVQPGMYGGY"
     atggcggctc cgcccgtcac cgtgaaggag gtggtctcgc tcacctcctc cggcatcaat        60
     ccgcaaaaca tctccttcac caacctcacg atggagtcgg agaagttcat ctgcgtgcgc       120
     gagactggtg cggccaactc cgtcgtcatc gtcgacatgg cccagccaat gacgcccatg       180
     aagcggccca tcaccgcgga ctcggcgctc atgaacccgg cggccaaggt gatcgcgctc       240
     aaggctaccg tggcgggaac cgcgcaggat caccttcaga tcttcaacat cgatacgaag       300
     tctaagatga agtcgcacca gatgcccgag agcgtcgtgt actggaggtg gatctccccg       360
     tccctgatgg gcatcgtgac aaacacggcc gtctatcact ggagcatgga gggcgattcc       420
     gagcctcaga agatgttcga tcgcacgggt aacctcaacg gctgccagat catcgcctac       480
     cgcgccagcc aggacatgaa gtggttctcg gttgtcggca tcgccgccgg cgatccctcc       540
     cgacccggcc tcgtcaaagg caagatgcag ctcttctcca aggaactcgg cagatcccag       600
     gagctcgacg cgcacgcctg tgccttctcc acgcaccagg tgaccggtaa cagcgtgaag       660
     tcccaggtga tcgcctttgc gcagaagacg gtgatgccgg acgggaacgt cgcgtccaag       720
     cttcacgtca ttgagctcgg cgctcaggcc ggccagactc ctttccagaa gcgccaggcg       780
     gagctgttct tccccccgga gttcatggac gacttcccgg tgaacatgtc aatatctgag       840
     aagtacggcg tcatctatgt ggtgaccaag atgggcctcc tctttgttta tgacttggag       900
     acggcgacgg ccatctatcg caacaaggtt agcaacgacc cggtcttcct cgcgtgcgac       960
     tccccctcca cgggcggcgt ctacgcggtg aaccgccgcg gccaggtgct cctgttgaac      1020
     cttaacgagc ctgccgtggt gccgttcatc tccgggcagc tcaacaacgt gagcctcgcg      1080
     cttcaggtgg cggtccgagg cggcctcccc ggtgccgagt ccctcgtgaa gcccaaattc      1140
     gagcagctct tcgccgcggg cgacatcaag ggcgccgccg agtgcgcggc ggattcaccc      1200
     aagggcatcc tccgtaaccc cgagaccatc gcgaggttca aggcgatccc ggcgcagccc      1260
     ggcgccgctc ctccgctcct ccagtacttt ggcatctgcc ttcagcgggg tacgcttaac      1320
     aaggttgagg gcgttgagct cgcgaggctc gtgctcgcgc agaacaagaa gcagctgctg      1380
     gacacgtgga tggcagagga caagatcgag tgctccgagg agctcggaga ccttctccag      1440
     tctgttgacg ccgacatggc actccgcgtg tacatcaagg cgaaggccaa caccaaggtt      1500
     gtcgccgcgc tcgccgcgcg cggggagttt gagaagatgg gcaagtactg cgagatggcg      1560
     gactacaagc ccgactactc ctacctgctg cagtcgacgc tcatgtcaaa cccccagggc      1620
     gcggtgacta ttgcgctgca ggttagcaag atgaatccgc ccccgctcga ctacaacacc      1680
     gtcgcggatc tcttcctcca gcgcaacatg atcagggagg ctaccagctt cctcctcgat      1740
     gtcctcaagg aggacaggga ggaccaggcg gcgatgcaga caaaggtgct cgagatcaac      1800
     ctcgtcacct tccccaacgt tgccgacgcc atcctcgggc agggcaagct cacgcattac      1860
     gacaggcccc gcatcgcgca gctctgcgag aaggccgggc tgtacatgcg cgcgctcgag      1920
     cactacaccg aggtgtcaga cctgaagcgg tgctgcgtca acacgcactc aattgacccc      1980
     caggcgctcc tcgagtggtt cggcaccctc tccagggagt gggcgctcga gtgcatcaag      2040
     gagctgctcg tgtccaaccc caggcagaac ctccagatca tcgtcaacgt gtgcaaggag      2100
     tacactgaac agatcggcgc tgatgccatc ctcaagctcc tcgaggagca caactcctcc      2160
     gagggcatgt tcttctacct tggcgcactt gtcgcgacca gcaccgagcc tgatcaccac      2220
     cagaagtaca ttgaggctgc cgccaagact ggccagatca aggaggtcga gcgcatcacg      2280
     cgcgaatccg agcactacga cccggagaaa gcgaaggtgt tcctcatgga ggccaagctc      2340
     ccggacgccc gcccgctcat caacgtgtgc gatcgctttg acatggtgga cgacctcacc      2400
     acgttcctgt accagaacaa gatgcttcgc tacatcgagg gatacgtgca gaaggtgaac      2460
     ccatccaaca cccccgtcgt cgtcggcgca ctcctggacc tcgagtgcga cgaggacttc      2520
     gtgcagaatc tcatcctctc cgtgcgctcg ctcctccccg tcggcccgct cgtcgaggag      2580
     gtgtccaagc gcaacaggct caagatgctc accccgttcc tcgagaacct cgtcgccgag      2640
     ggatccacca acgcggatgt ccacaacgct ttgggcatga tcctcatcga ctccaacacc      2700
     aaccccgagc acttcctcac caccaacgag tactacgact ccaaggttgt gggtaagtac      2760
     tgcgagaaga gggatcccaa cctcgcgtgt gtggcgtaca aacgcggcaa ctgcgacctc      2820
     gagctggtgg aagtcaccaa caagaactct ctgttcaagc tccagtccag gtacgtcgtg      2880
     gagcgcatgg acgcggacct gtgggagcac gtgctcgcag aggataatcc ccaccgcaga      2940
     caactcatcg accaggttgt gtccaccgcg ctgcccgagt caaagaaccc tgagcaggtg      3000
     tctgtcaccg tcaaggcgtt catgactgcg gagatgcccc aggagctcat cgagctgctg      3060
     gagaagatcg tcatccagaa cagcgcgttc agcaacaacc caaacctcca gaacctgctc      3120
     atcctcaccg cgatcaaggc ggacaccacc cgcgtaatgg actacatcaa ccgcctcgac      3180
     gccttcaacg gcccggaggt tggcgagatt gccgttggca acgagctcta cgaggaggcc      3240
     tttgcgattt tcaagaagtt cgacctccac gtggacgcca tgaaggttct cttggagaac      3300
     ctggagaacc tcgaacgcgg agaggagtac gccaacaagg ttgacctccc tgaggtttgg      3360
     tcacagctcg cgaaggcata cctgtcccag gacctggtct ctgccgccgt ggctgcctat      3420
     atcaaggcca agtacaccga cgactacctc gcggtgatcg acgtggcaaa gcgcgcggat      3480
     gacttcgaca gcatggtcaa gtacctggcg atggtgcgca agaaggtcaa ggagccgaag      3540
     gttgactctg agctttgcta cgcgtatgca aagacggata agctcgcgga gctcgaggag      3600
     ttcatcaccc agcccaacgc cgcgaagctg gacaacgtcg gcgatcgatg cttcgacgag      3660
     ggcctgtacg aggctgctaa ggttcttttc acgacgtgct ccaactgggg ccggctggcg      3720
     agcaccctgg tcaagcttca caaattctcc gaggctgttg acgcggctcg caaggcgaac      3780
     aacacgcgca cctggaagga gatttgcttc gcgtgcgtgg acgagggcga gttcaggctg      3840
     gcacagctgt gcgcgctgaa catcatcgtc aacgcggacg agctggagga aatctcggag      3900
     tactaccagg tgcggggcag gtacgaggag ctcctgtccc tgatggaggc tggcgttggc      3960
     ttggagaggg cgcacatggg catcttcacc gagcttggca tcctctacgc caagttcaag      4020
     cccgagaagc tcatggagca cctcaagctc ttcagcaccc gcatcaacat ccccaagctc      4080
     atccgcgcct gcgaggagat gcacgcctgg aaggagctct cgttcctcta cattgcgtac      4140
     gacgagtacg ataacgctgc gggtgtgatg atggcccacc ccgacgcgtg ggagcacgtc      4200
     ggcttcaagg acgtctgcgt caaggttgcc aacctggaga tttactacaa ggcgctcgag      4260
     ttctacctcg tgagccaccc cacgcagctt aacgacctgc tcacggtgct caccccgcgc      4320
     atcgaccact cgagggtcgt cgcgctcatg cgccaggcga accacctgcc cctgatcaag      4380
     ccctatctgc aagctgtgca gaacaccaac atggttgccg tcaacgatgc ggtgaacgag      4440
     ctgtgcctcg aggaggagga tttcgagtcg ctccgaacct ccatcgacac ttacgacaac      4500
     ttcgaccaga tgtcgctggc gaacaagtgc gagaagcacg agctcctcga gttccgccgc      4560
     atcgccggct tcctctacca aaagaacgcc aagtggacca aatccgtgga gctgtccaag      4620
     aaggacggct tgtacaagga tgcgatggag gcagccgcgc agtccggcga caaggacatt      4680
     gccggtgatt tgcttcagtt cttcatcgag caggagaaca aggagtgctt cgccgcgatg      4740
     ctatacaact gctacgacct gctcaagcct gacgaagtgc tcgagatagc gtggatgaag      4800
     ggcctcatgg agtacgcgat gccctacatg atccaggtca tgaaggacta caccaacaag      4860
     gttgacgtgc tggtggagga caagaaggac cgcaacaagg agaaggcgga tcaggagaag      4920
     gagaaagtgg agcagcagat gaaccagaac atgtacgcgc agctgctccc cgcggcgctc      4980
     cccgcgcccg gcatggaaac caccggtggg atgaacaacc cgggcatgta tggccagatg      5040
     ggcggcgttc agccggggat gtacggggga tactaa                                5076
//

If you have problems or comments...

PBIL Back to PBIL home page