(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE441

MICSR_1.PE441        Location/Qualifiers
FT   CDS_pept        867909..869153
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637359"
FT                   /orf_name="MICPUN_107928"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61814.1"
FT                   /db_xref="UniParc:UPI000199AB48"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W8"
FT                   /transl_table=1
FT                   /translation="MRMEKAKALREELDGVRTRSRRLLAKGNRLVERGVQLKAAAERVM
FT                   LGNEINKEDEARRLLVERKKVKDTLDLTTARAEVLAELASKLETAIIVLENATDEESVD
FT                   AAKALAADTLPAAKRASLQEFKTAPVSSRPASMGEDDVSQDSIAERFGRDSLEREFAAL
FT                   EITQLERMLRLTPDDPRISSEDTVVKEDDDDVVVSNTEPAWWQAPSQPKDADGATMTPR
FT                   EALLEVDRARVSSKGVQGHHVVALRKSCAVHGAGTIRVSDRLIGGKKDTAFRAGVGAAM
FT                   TAMETGEGETTGWSSLGGYEPTVFLSDLARDLGVTPERAGVLVANATARKSAAALLQAG
FT                   ASVRGGEAESARVDLKKLTSVLRTFRACAGEYLDLVAFGLEQQLSEAERKIVLGLVPKE
FT                   TSEDVRGAIRCALGL"
     atgcgcatgg agaaggccaa ggcacttcgg gaggaactcg acggagtccg gacaaggagt        60
     cgaaggctcc tcgccaaagg caaccgtctg gtcgagaggg gcgtccagct caaggctgcg       120
     gcggagaggg tgatgctcgg caacgagatt aacaaggagg acgaggcgcg caggctgctc       180
     gtcgagcgaa aaaaggtcaa ggatactctg gatctcacga cggcaagggc ggaggtcctc       240
     gccgagctcg cgagtaagct ggagactgcg ataatcgtac tggagaacgc gacggacgag       300
     gagtctgtcg acgccgccaa ggccctcgcc gcggacactc ttcctgccgc gaagagggca       360
     tcgctccagg agttcaaaac cgcgccggtg agctcacgcc ctgcatcgat gggggaggat       420
     gacgtgtcac aagattcgat cgccgagcgg ttcggtcgag actccctcga gagggagttt       480
     gccgctttgg aaataacgca gttggagcgg atgctgagac tcacacccga cgacccgcgg       540
     atatcttccg aggatacggt cgtcaaagaa gacgacgatg acgtcgtcgt gagtaacacc       600
     gagcccgcgt ggtggcaagc gccgtcgcag cctaaagacg cagacggcgc gacgatgacg       660
     ccgcgagagg cgctcctgga ggtggatagg gccagggtat catccaaagg agtgcagggg       720
     caccacgtcg tggcgctcag gaaatcatgc gcggtgcatg gtgcgggcac catccgcgtc       780
     agcgatcggc tcatcggggg taagaaagac acggcgtttc gagccggggt gggagccgcc       840
     atgaccgcca tggaaaccgg ggagggtgaa actaccggtt ggtcgtcgct cggcggctac       900
     gagccgactg tttttctgtc cgacttggcg cgggatctgg gcgtgacgcc ggaacgggcg       960
     ggcgtgctgg tggccaacgc gacggcgagg aagagcgccg ccgctttact tcaggccgga      1020
     gcgtccgtgc ggggcggcga ggcggagagc gccagggtgg acctgaaaaa attaacttcg      1080
     gtcctgcgaa cgtttcgcgc gtgcgcgggg gagtacctcg acctggtggc gttcggtctc      1140
     gagcagcagc tgtcggaggc tgagaggaag atcgtgttgg ggctcgtgcc gaaggagacg      1200
     agcgaggacg tccgcggcgc gattcgatgc gctctcggcc tgtag                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page