(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE442

MICSR_1.PE442        Location/Qualifiers
FT   CDS_pept        complement(871781..874495)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637360"
FT                   /orf_name="MICPUN_57025"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62240.1"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AB49"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W9"
FT                   /transl_table=1
FT                   /translation="MCSRQPPGELAWGRAPRRRGGARNALPQPWKLRLDQRISGKSVRA
FT                   RLVTTRAPRGPGRRFETMQAGVASRSWAPDVADRRRGRGTRTSRRQRRVAVRAAQTGTR
FT                   DDSDDVTARDAWADLGPAGHRRGTNRIAETSAATAAVPAVDAPKSGLKVDPITAAAGGT
FT                   ALAAAGVVAALRSNPKATEELVHLKELMEHRAEVLREFGTGTGREMFPVIRRYAEQIQR
FT                   RYDVLLLPNGVETMIYAEIVKTGAIGAYESLYDNVRNVNLLGHPLKLKTIANLGHQPPV
FT                   PKVNMEDCEEFVTSVLFDDEDENVGLGIIPRPLEVQIYRNAMVTAVYLMEDTLEHFNVR
FT                   FFGTQYSFEFGRPDEGWRTSKNHPTLSDSALRRLVREEIQAPAVLRLAPGVEKNAGKVA
FT                   VALAGEVVGSAEINFLGLPLRFSLQPGGDEAFSSDIGRIPSLSEAGKLVPGGGEVLPNF
FT                   NPATAVIKQNVCSETLEIIENYVELYLESRPKQNIITNPFFFSKKLERETYVGFLSAVI
FT                   GSLENSVICELMGMDVVLNVGSAARDKKGKIKPPNLSTFKVSSDFGDNRREIEELVDWL
FT                   MKDPMYNIKAVPDNIERAIYCNVFELVTNILAGALSSLEIEILGRAVRLKLSEANKRDR
FT                   ADLAKLSRFRPSNEVLQKFSENFSAVPALQEVMMNVYAFVLAFVSYELSNVDVNLVGRK
FT                   LQFSLGVPSEVDERLAAEKMKEESEFNARLRQALNTLVEEMVEAAEEISGKEIDVNLEK
FT                   IEEYERDVLANVGLRASKVKDEVWKFASGVFGSRDDSEGAVAPTTGGASSSAVSNDDLD
FT                   SVIYKTFLAHHSPANKEFPFPYLSPKDFRFAVSDLVKIVRPGGGPDDKFTVSAAAVQKV
FT                   ANAADINGDGVIQWAEYYFAAKELSYLFEVKTP"
     atgtgctcgc ggcagccgcc aggcgagctt gcatggggaa gggcgcccag gagacgaggg        60
     ggcgcgcgca acgctctgcc gcaaccttgg aaactccgac tcgatcagag gatttccgga       120
     aaatcggttc gggctcgcct ggtcacaacg agggcgcccc gcggccctgg gcggaggttc       180
     gaaacgatgc aggcgggcgt cgcctcgcga tcatgggcgc cagacgtcgc agaccggcga       240
     cgcggtcgtg gaacccgcac ctcgcggcgg caacgacgcg tggccgttcg cgccgcgcag       300
     acgggcaccc gtgacgattc ggacgacgtc acggcgcggg acgcctgggc tgacctgggg       360
     cccgcgggac accgacgggg caccaacagg atcgctgaga cctcggcggc gaccgcggct       420
     gtgcccgcgg tcgacgcacc gaaatccggg ctcaaagtag acccgatcac cgcggcggcg       480
     ggcgggacag cgctggcagc cgcgggcgtc gtcgccgcgt tgagatccaa cccgaaggct       540
     acggaggagc tcgtgcacct caaggagctc atggagcacc gggccgaggt gctccgagag       600
     ttcggcaccg gcactggacg ggagatgttc cccgtgatcc gacggtacgc cgagcagatt       660
     cagcgcaggt acgacgtgct gctgttgccg aacggcgtcg agacgatgat ttacgccgag       720
     attgtgaaaa ccggcgccat cggcgcgtac gagtcgttgt acgataacgt gcggaacgtg       780
     aacctgctgg ggcacccgct gaagctcaag acgatcgcaa accttggtca ccagcccccg       840
     gttcccaagg ttaacatgga ggactgcgag gagtttgtca cgagcgtttt gtttgacgac       900
     gaggacgaga acgtggggct cggtatcatc ccgcggccgc tggaggtgca gatataccgc       960
     aacgccatgg tgacggccgt gtacctgatg gaggacaccc tggagcactt taacgtccgg      1020
     ttcttcggga cgcagtactc gttcgagttc gggcggccgg acgaggggtg gcgcacgagt      1080
     aaaaaccacc cgacgctgag cgactcggcg ctccgaagac tggtgaggga ggagatccag      1140
     gcgccggctg ttctgcgcct cgcgcccggg gtggagaaga acgcgggtaa ggtggcggtg      1200
     gcgctcgcgg gtgaggttgt gggctcggcg gagatcaact tcctcggcct gcccctgcgt      1260
     ttcagcctcc agccgggcgg cgacgaggcg ttctcttcgg acattggccg gatcccgagc      1320
     ctgtccgagg cgggcaagct cgtcccgggc ggcggcgagg ttcttcccaa ctttaacccc      1380
     gccacggccg tgatcaagca gaacgtgtgc tcagagacgt tggagattat cgagaactac      1440
     gtggagctct acttggagag caggccgaag cagaacataa tcaccaatcc cttcttcttc      1500
     agcaagaaac tggagaggga aacgtacgtc ggcttcctct ccgccgtcat cggaagtttg      1560
     gaaaactcgg tgatttgtga actgatgggc atggacgtgg tgttaaacgt aggtagcgcg      1620
     gcgagggaca agaagggtaa aataaagccc ccaaacctca gcaccttcaa ggtttcgtcg      1680
     gactttggcg acaacagacg ggagattgag gagctcgtgg actggctcat gaaggacccg      1740
     atgtacaaca tcaaagccgt gcccgataac atcgagcgcg ccatctactg caacgtgttc      1800
     gaactggtga cgaacatcct cgcaggagcg ctgagctcgc tcgagatcga gattcttggt      1860
     cgcgcggtgc gactcaagct gagcgaggcc aacaagcggg accgcgccga cctcgccaag      1920
     ctcagccggt tcaggccatc caacgaggtt ttacaaaagt tttcagaaaa cttcagcgcg      1980
     gtgcccgctt tacaagaggt gatgatgaac gtgtacgcgt tcgtcctcgc gttcgtgtcc      2040
     tacgagctgt cgaacgtgga cgtcaatctg gtgggcagaa agctccagtt ttcgctcggc      2100
     gtgccatccg aggttgacga gcgtttggct gcggagaaga tgaaggagga gagcgagttc      2160
     aacgccaggt tgcgacaggc gcttaacacc ctcgtggagg agatggttga ggcggcggag      2220
     gagatcagcg gcaaggagat tgacgtcaac ctggagaaaa tcgaggagta cgagcgggat      2280
     gttctcgcaa acgtgggtct gcgggcgagc aaggtcaagg acgaggtgtg gaagtttgca      2340
     agcggggtgt ttggatccag ggatgactca gaaggggccg tggcaccgac gacgggtggt      2400
     gcgtcgtcgt ccgctgtcag caacgatgac ctggacagcg tcatctacaa gaccttcctt      2460
     gcgcatcact cgcccgcgaa caaggagttt ccgtttccat acctgagccc taaagatttt      2520
     aggttcgcgg ttagcgacct cgtgaagatc gtgcgtcccg gcggtggccc ggatgataag      2580
     tttacggtgt ctgcggctgc ggttcagaag gtggcgaacg cagcggacat caacggcgat      2640
     ggggtgatcc agtgggcgga gtattacttc gcggcgaagg agctatcgta tctctttgag      2700
     gtcaagacac cgtga                                                       2715
//

If you have problems or comments...

PBIL Back to PBIL home page