(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE443

MICSR_1.PE443        Location/Qualifiers
FT   CDS_pept        join(874645..875544,875605..875772)
FT                   /codon_start=1
FT                   /gene_family="HOG000084891" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637361"
FT                   /orf_name="MICPUN_79866"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61815.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG560215"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199AB4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X0"
FT                   /transl_table=1
FT                   /translation="MVPRVFVVSDIHTDFEENMKWVRGLSDTKYANDAIILAGDVSDDL
FT                   SVLGETLVLFASKFRHAFFTPGNHELWCKRRGPLKDGESEADRETIPDSMTKLERVLRL
FT                   CDECGVETRPRLIGDGERKLWIAPVVAWYHSSFDYEPDITETRVHPPHLVMSDFRLCEW
FT                   PGLDPKDESVAEAMDAVNDARGWGTFLEWLRRPEQSAADASVPIVSFSHFLPRLELCPE
FT                   KRMLFYPNLPKAVGSDFVMRRIQNLRAEQPPGTRRKRMHVHCFGHTHFGWDATIDGVRY
FT                   IQAPVSYPHEWKQRPGSLTPCCIFDWEQHGGFAPKMSARWSDHYASNPRTPQNTELAWW
FT                   VRGSALKGRADDESD"
     atggtgccca gagtgttcgt cgtgagcgat attcacaccg acttcgagga gaacatgaag        60
     tgggtgaggg gtctgagcga caccaagtac gcgaacgacg ccatcatcct cgccggggac       120
     gtgtccgatg acctgtcggt gcttggggag accctcgtcc tgttcgcctc gaagttccgg       180
     catgcatttt tcacacctgg caatcacgag ctctggtgca aacgacgcgg gcccttaaag       240
     gacggcgagt ccgaggcgga cagggagaca atcccggact cgatgaccaa gctcgagcgc       300
     gtgctccggc tgtgcgacga gtgcggcgtg gagacgaggc cgcggctcat cggcgacggg       360
     gagagaaagc tgtggatagc tccggtggtg gcgtggtacc actcatcctt cgattacgag       420
     cccgacatca cggagacccg cgtgcacccg cctcacctgg tcatgagcga ctttaggctg       480
     tgcgagtggc cggggctcga ccccaaggac gagagcgtcg ccgaggcgat ggacgcagtg       540
     aacgacgctc gcggctgggg tacatttttg gagtggcttc gaaggcccga gcagtcggcg       600
     gcggacgcgt ccgtgcccat cgtgtcgttc tcgcacttcc tcccgcggtt ggagctgtgc       660
     ccggagaaac gcatgctatt ctacccgaac cttcccaagg cggtgggctc cgactttgtc       720
     atgcgtcgca tccaaaacct tcgcgccgag caaccgccgg gcactcggcg caagcggatg       780
     cacgtgcact gcttcgggca cacgcacttc ggctgggacg ccacgattga cggggtgcgg       840
     tacatccagg cgcccgtctc ctacccgcac gagtggaagc agcggcccgg gtccctcacc       900
     ccgtgttgca tcttcgactg ggaacaacac ggagggttcg cgcccaagat gagcgcgagg       960
     tggagcgacc actacgcgag caacccgcgg acgccgcaga acacggagct cgcgtggtgg      1020
     gtgcggggat ccgccctgaa aggcagagcg gacgatgagt cggactag                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page