(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE445

MICSR_1.PE445        Location/Qualifiers
FT   CDS_pept        878017..880236
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637363"
FT                   /orf_name="MICPUN_107929"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61816.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AB4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X2"
FT                   /transl_table=1
FT                   /translation="MSYFNMVFLAMFAISAFLIPGVQRKLIKEVDANMCTIEDYSVIIT
FT                   DLPDDVKDQELHKFFDKKVGKVQNVVVATNNAELLTLAFERQKAKELFHIQVAKYKKGR
FT                   EDPDVSDKKVEWLHEEAVKAKKGLRACDSAIRALQNDRGGDAKRAICAFVTFQEEADFL
FT                   KMFDMYRPGIFAWLWRPVDLRLRKKHRLRVKQAPPPADIRWENLQFNWAQRSFRQLNIS
FT                   LLTAVVLGLAFVSIAAVQMMAANAATPYDTEECRLNCHYGTDPVTMENEDLRNIYLKCY
FT                   EAEQEGDPKRDITQTPSPPPPPAYGRRLMAQDLVSSQANYVASHNGTCGAFDSFCYACY
FT                   CLEHISAGSVLDESEYCQPYIFGYTMQVVAQSVASAIVVVLNLLLKPLLVFLVRFEKHH
FT                   SASGEQMSVMLKLFMAQFFNTAILLVVLNGSFPWLRAQLEGTPVEGLLFQGEMEDFVPA
FT                   WYNEVGYALVISMVATPASQRIFSIIRLFRFKIGKFFASRNAVTQDQLNKAFEGMEFNL
FT                   AINYGELLNILFVTLTFSPGLPILVPLTSFAYMVRYGFDKYEFARVSKMPPWYSTILGM
FT                   GVAHLMAYACLGYLILAIWANSYYTMAPDPMIEGLIGSALYGFCDAWESLPEPLASVFG
FT                   TMSDPSEMARRALQKNTAIYTLTLFIIVVILFFRGLIATMRSILAEIYPAYFQTDKRQA
FT                   EGNPTFDLAIAGSQLLGARTYSIRDAPQYQAAFERIVWELDDGKL"
     atgtcctact tcaacatggt tttcctcgca atgtttgcca tctccgcgtt tctcattccc        60
     ggggtccaac ggaagctcat aaaggaggtt gacgcgaaca tgtgtacgat cgaggactac       120
     agcgtcatca taacagacct cccggatgac gtcaaggatc aggagcttca caagtttttt       180
     gataagaagg ttggcaaggt tcagaacgtc gtggtggcga cgaataacgc ggagctactc       240
     acgctggcgt tcgagcggca gaaagcgaag gaattgttcc acatacaggt ggccaagtac       300
     aagaagggac gggaggatcc agacgtgagc gataaaaaag tggagtggct tcacgaggag       360
     gcggtgaagg cgaagaaagg acttcgcgcg tgcgactctg ccatcagggc gcttcaaaac       420
     gaccgcggcg gcgacgcgaa acgcgccatc tgcgcgtttg tcacgttcca ggaggaggcg       480
     gattttctca agatgttcga catgtaccgg cccggtatct ttgcgtggct gtggcgcccc       540
     gtcgacctga gactccgcaa gaaacaccgg ctcagggtca aacaggcgcc gccgcctgcg       600
     gatatccgat gggagaacct gcagttcaac tgggcccagc gcagcttcag gcagctcaac       660
     atctcactac tgaccgccgt ggtcctgggc ttggcgttcg tctcaatcgc ggcggtgcag       720
     atgatggcgg cgaacgcggc taccccgtat gacacggagg agtgccgcct caactgccac       780
     tacggcacgg acccggtgac catggaaaat gaggatcttc ggaacatcta cctcaagtgc       840
     tacgaagccg agcaggaagg ggatcctaag agagacatca cgcagactcc gtccccgccc       900
     ccgccccccg cctacggcag gaggctcatg gcacaggatt tggtttcgtc gcaggcgaat       960
     tatgtcgcga gccacaacgg gacctgcggc gcctttgact cgttctgcta cgcgtgctac      1020
     tgcctagagc acatctccgc gggttccgtg ctggacgagt cggagtactg ccagccatac      1080
     atcttcgggt acaccatgca ggttgtggct caatccgtgg cgagcgccat cgtggttgtc      1140
     ctgaacctcc tgctgaagcc tctgctggtt ttcctggtgc ggtttgagaa gcatcacagc      1200
     gcgagtggcg agcagatgtc ggtgatgttg aagctgttca tggcgcagtt cttcaacacc      1260
     gcgatcttgc tcgtagtgct gaatgggtcg ttcccgtggc tgagagcgca gctcgagggg      1320
     acgccggttg agggcttgct gttccagggt gaaatggagg attttgttcc ggcgtggtat      1380
     aacgaggtgg gctacgcgct ggtcatctcc atggttgcca cgccggcgtc gcagcggatt      1440
     ttttccataa tccggctgtt cagatttaag attggcaagt tcttcgcctc gaggaacgcc      1500
     gtgacgcaag atcaactcaa caaggcgttc gaagggatgg agttcaacct cgccatcaac      1560
     tacggggagc ttctgaacat cctctttgtc accctcacct tttcgcccgg cctccccatc      1620
     ctggtgccgc ttacttcatt cgcgtacatg gtgcgctacg gcttcgacaa gtacgagttt      1680
     gcccgggtga gcaagatgcc cccgtggtac tccacgatcc ttggcatggg cgtggcccac      1740
     ttgatggcgt acgcgtgcct cgggtacctc atactcgcca tatgggcaaa ctcctattac      1800
     accatggcgc cggacccaat gatcgagggg ctcatcggca gcgcgctcta cggcttctgc      1860
     gacgcgtggg agagcctccc cgagccgcta gcgagcgtgt tcgggacgat gagcgacccg      1920
     agcgagatgg cgagaagggc tttgcagaag aacactgcaa tctacacgct gacgctcttc      1980
     attatcgtcg tgattctgtt tttccgtggg ctaatcgcga cgatgcgaag catcttggcg      2040
     gaaatatacc cggcatactt ccagactgac aaacgacagg ctgagggtaa cccaacattc      2100
     gacctggcaa tcgcggggtc gcagctgctg ggcgcgagga cgtattcgat ccgcgatgcc      2160
     ccgcagtatc aggcggcgtt tgaacgaatc gtttgggagc tggacgacgg caaactgtaa      2220
//

If you have problems or comments...

PBIL Back to PBIL home page