(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE446

MICSR_1.PE446        Location/Qualifiers
FT   CDS_pept        883118..884770
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637364"
FT                   /orf_name="MICPUN_57030"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61817.1"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI000199AB4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X3"
FT                   /transl_table=1
FT                   /translation="MATKSFAELCEMSASKGGMEKTVKFTYDEHVSVVMAAFRERSQGP
FT                   HPSMPLVHRVDILDERPEKPDSDGTDTESWAMRYRRFFAENDAPPWVKKISGGEYLRGT
FT                   ERIEWSEPAGKMVMYTVNESHSQLVTAEEICIIEADPERPHTGTIKTLTVRARLRLRGW
FT                   WTLGISAIAERFLLGRYVSLVNQGRKIELEEIRKWRHTGKAELVLRGAFERSRTPSSER
FT                   ALGMILAGGTSKLPSLEPEADEGGKVSPKSTLSRLRGNSAPSVDGLEVESLEEFERSIS
FT                   EKDPRETTDEIVQAGMSEVHWLGLRYAKRREEIFDESSTDSDEYAYESTPRPESPLLSY
FT                   ASTDEDEYEYDSTPRPESPLYVPLDTDDEDVEDDENGEETPAVDAVIDDEFRSSGSPGA
FT                   ASPIWSPGDERTVLDVSVDEATIAKSLAKDWKEIEALEHEAIRRKLGLGEEDGDEGGAA
FT                   GALRRWLVRLALVGAGAAILRERRDQLLPLAVRAKKRWTRGRRPVKASASVVDAAAMVD
FT                   ESEEEGEVSAVVEAGEEAAAEAVTPEVDDADDE"
     atggcgacca agtccttcgc cgagctgtgc gagatgtcag cctccaaggg cgggatggag        60
     aagacggtga agttcacgta cgatgagcac gtctccgtcg tgatggcggc gttcagagag       120
     aggtcgcagg gaccgcaccc ctccatgccg cttgtccacc gcgtggacat cctggacgag       180
     aggcccgaga agcccgactc ggatggcacg gacaccgagt catgggcgat gcgctaccgc       240
     cgcttcttcg ccgagaacga cgcgccgccg tgggtcaaga agatcagcgg tggcgagtac       300
     ctcaggggca ccgagcgcat cgagtggtcg gaacccgcgg gcaagatggt catgtacacc       360
     gtcaacgagt cccactccca gcttgtcacc gccgaggaga tttgcatcat cgaggcggat       420
     cccgaacgac cgcacacggg aaccatcaag acgctcaccg tccgcgccag gctccgactt       480
     cggggctggt ggaccctcgg catctccgcc atcgccgagc ggttcctcct cggcaggtac       540
     gtctccctcg tgaaccaggg gcgaaagatc gagctcgagg agattcggaa gtggcgccac       600
     accggcaagg cggagcttgt cctgcgcggc gcgtttgagc gctcgcgcac ccccagctcc       660
     gagcgcgcgc tcggcatgat cctcgcgggc ggcacttcca agctgccgtc gctcgagccc       720
     gaggctgacg agggcgggaa ggtatcgcca aagtccacgc taagccggct ccgcggaaac       780
     agcgcgccca gcgtcgacgg cctcgaggtg gaatccctcg aggagttcga gcgatccata       840
     tccgagaagg atccgcggga gacgacggat gagatcgtgc aggcgggcat gagcgaggtc       900
     cactggctcg ggctgaggta cgccaagcga cgggaagaga ttttcgacga gtcttcgacc       960
     gactctgatg agtacgccta cgagtccacg ccgaggccgg aatcgcccct cctcagctac      1020
     gcctccacgg acgaggacga gtacgagtac gattccacgc ctcggcctga gtccccgctg      1080
     tacgtcccgc tcgacaccga cgacgaggat gtcgaggatg acgagaacgg ggaggaaacg      1140
     ccagctgtgg acgcagtcat cgacgacgag ttccgcagca gcgggtcgcc gggcgcagcg      1200
     tcgccgatat ggtccccggg cgacgagcga acggtcctcg acgttagcgt ggacgaggca      1260
     acaatcgcca agagtctcgc gaaggattgg aaggagatcg aggcgttgga gcacgaggcg      1320
     atccgtcgaa agctgggcct cggcgaggag gatggggatg agggcggcgc tgcgggcgcg      1380
     ttgaggagat ggttggttcg gctcgcgctg gtcggcgcgg gggcggcgat cctgcgggag      1440
     cggagggacc agctgctgcc gctcgcggtc cgggcgaaga agaggtggac gcgcgggcga      1500
     cgcccggtga aggcgtcggc gtcggtggtg gatgcagcgg cgatggtgga cgagtcggag      1560
     gaggagggcg aggtttccgc ggttgtcgag gctggggagg aggcggcggc tgaggcggtg      1620
     accccggagg ttgacgacgc ggatgatgaa tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page