(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE447

MICSR_1.PE447        Location/Qualifiers
FT   CDS_pept        complement(884893..886434)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637365"
FT                   /orf_name="MICPUN_99522"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62242.1"
FT                   /db_xref="UniParc:UPI000199ABBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X4"
FT                   /transl_table=1
FT                   /translation="MRDTNVDWIHDLPFHSFDAGAYGRSVAHVAFTYSTPWLALTAVTV
FT                   VAWAQFHRGCLCGRRSLPRRPVALGMKPAMIMFLIMAWIACSLVPSAYTRFHEGSRDVD
FT                   DALHALDAHATGAMGHAARAKSAAAECSAALAAVDAQFKEHMAAALKVQRARQAAEQFA
FT                   AAAEGVGGVAWKDLDVLRGYDDKWERFDTWFTALSATTYGLLIVASLAPVVARLLMLST
FT                   ASRSTVDAVDAALRFAPFVAMIAAWLFLAASSPATVTFAETCHAWVPTVTRTVPTDSAR
FT                   FYFFCGVGESASVDAIPKIPAPSPAIASMRAASIEFRASVEAVLTLDTSLSNAGRNVTT
FT                   AALKRVERCEASGMEFETSVADSLGGCDPMGANLRTARESACGDAVTGIFWNNIAIMLL
FT                   AFVIFYHALRGWLWELWEWVAMGDVVYGGDSPVRKFSGKGYGSGASPRDVESQMERLEG
FT                   DVRGVKGDVKYVMGKVDEMVPLMRDLEAASRVNSPVGKGSPEEKLKQAAAALARR"
     atgagggaca ccaacgtgga ttggatccat gacctgccct tccacagctt tgacgccggc        60
     gcctacggcc ggagcgtggc gcacgtcgcg ttcacgtact ccacgccgtg gctcgcgctg       120
     accgcggtca ccgtcgtggc ttgggcacaa tttcacaggg ggtgcttgtg cggtcggcgg       180
     tcgcttccga ggcggcccgt ggcgctgggg atgaaacccg cgatgatcat gtttctcatc       240
     atggcgtgga tagcgtgcag cctggtgccg tcggcgtaca caaggttcca cgagggctcc       300
     agggacgtcg acgacgcgct ccacgccctg gacgcgcacg cgaccggcgc catgggccac       360
     gcggcgcggg cgaagagcgc cgcggcggag tgttccgcgg cgctcgcggc ggtggacgcg       420
     cagttcaagg agcacatggc agccgcgctc aaggtgcagc gcgcgaggca ggcggctgag       480
     cagttcgccg ccgcagcgga gggcgtcggg ggcgtggcct ggaaggatct cgacgtcctc       540
     cgcgggtacg acgacaaatg ggaacgcttt gacacctggt tcacggccct ctccgccacc       600
     acgtatgggt tgttgatcgt cgcctcgctc gcgcccgtcg tcgcgaggct tctcatgctc       660
     tccacggcgt ccagatccac ggtggacgcg gtcgacgccg cgcttcggtt cgcgccgttc       720
     gtcgcgatga tcgccgcgtg gctcttcctc gcggcgtcat cccctgcgac ggtgacgttc       780
     gccgagacct gccacgcgtg ggttcccacc gtcacgagga cggtaccgac ggactcggcg       840
     cggttttact tcttctgcgg cgtgggggag tcggcgtcgg tggatgccat cccgaaaatt       900
     ccggcgccgt cgcccgccat cgcgtcgatg cgagccgcat ccatcgaatt tcgcgcatcc       960
     gtcgaggctg tgttaacgct ggacacctcg ctgtcgaacg cgggacgtaa cgtcacgacg      1020
     gcggcgttga agcgcgtgga gcggtgcgag gcttccggga tggagttcga gacgtcggtg      1080
     gcggattctc tcggcggatg cgacccgatg ggcgccaatc tgcgaaccgc gagggagagc      1140
     gcgtgcggcg acgccgtcac cggcatcttc tggaacaaca tcgcgatcat gctgctcgcg      1200
     ttcgtgattt tctaccacgc gctgaggggt tggctgtggg agctgtggga gtgggtcgcg      1260
     atgggcgacg tggtgtacgg gggggacagc ccggttcgca agttttctgg caaggggtac      1320
     ggatcggggg cttcaccacg agacgtcgag tcgcagatgg aaaggctgga gggggacgtc      1380
     aggggcgtga agggggacgt gaagtacgtg atgggcaagg tggacgagat ggtgccgctc      1440
     atgcgtgacc tggaggctgc gtcccgtgtg aattcgccgg ttggcaaggg ttcgccggag      1500
     gagaaactga aacaagcggc cgcggcgctc gctcgccgtt aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page