(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE450

MICSR_1.PE450        Location/Qualifiers
FT   CDS_pept        891157..892089
FT                   /codon_start=1
FT                   /gene_family="HOG000264906" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637368"
FT                   /orf_name="MICPUN_57034"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61819.1"
FT                   /db_xref="HOGENOM:HBG560221"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniParc:UPI000199ABC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X7"
FT                   /transl_table=1
FT                   /translation="MAETAGPKIGDARSLWNFTPSPGWTKDECATLRLCLMKFGIGRWV
FT                   QIVDSGVLPGKQIQQLNGQTQRLLGQQSLAEYTGMHVDVDRIREDNNEKTGPDIYRKNG
FT                   LITNTGGKLKKEAMQALRAENKAKYGLSETEIAEIVLPDPPSKKKLGADAYMGKNHNKG
FT                   GVAGLTRRMEKRRRTADVLTVDVDALARPAKMALLKALRARLVVLTTAAEEGRVLKENK
FT                   AKAAAKPKPEAKKRAASSKRKSVDSASGEENDAPTPKRDTARRASAGCGGVVGQLVAMG
FT                   FDKKKAAEAVKEVGNDTMECVNWLVVNCA"
     atggctgaaa ccgccggacc taagatcggc gacgcccggt ccctgtggaa cttcaccccg        60
     tctcccggct ggaccaagga tgagtgcgcc acgctgcgcc tgtgcctcat gaagttcggc       120
     atcgggcggt gggtgcagat cgtggacagc ggcgtgctcc cgggcaagca gatccagcag       180
     ctgaacggcc agacccagcg tctgctcggc cagcagtccc tcgccgagta caccgggatg       240
     cacgtcgacg tcgaccgcat ccgcgaggac aacaacgaga agaccggccc cgatatctac       300
     cgcaagaacg gcctcatcac caacaccggt ggcaagctca agaaggaggc gatgcaggcg       360
     cttcgcgcgg agaacaaggc caagtacggc ctcagcgaga cggagatcgc ggagatcgtt       420
     ctccccgacc cgccgagcaa gaagaagctc ggcgcggacg cctacatggg caagaaccac       480
     aacaagggcg gcgtggcggg gctcacgcga cggatggaga agcgcaggcg caccgcggat       540
     gtcctcaccg tggacgtcga tgccctcgct cggccggcga agatggcgct gctcaaggct       600
     ctccgcgcca ggctcgtggt gctcacgacc gcggcggagg aagggcgcgt gctcaaggag       660
     aacaaggcga aggcggcggc aaagcccaag cccgaggcga agaagagggc cgcctcgtcc       720
     aagaggaaga gcgtggactc cgcgtccggg gaggagaacg acgccccgac tcccaagcgg       780
     gacaccgcga ggcgagcatc cgcgggctgc ggcggcgtgg tcggccagct cgtcgcgatg       840
     ggcttcgaca agaagaaggc ggcggaggct gtcaaggagg ttggcaacga cacgatggaa       900
     tgcgtcaact ggctcgtggt caactgcgcg tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page