(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE452

MICSR_1.PE452        Location/Qualifiers
FT   CDS_pept        893098..894243
FT                   /codon_start=1
FT                   /gene_family="HOG000241816" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637370"
FT                   /orf_name="MICPUN_80110"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61820.1"
FT                   /db_xref="HOGENOM:HBG746219"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI000199ABC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X9"
FT                   /transl_table=1
FT                   /translation="MATTDEFVPLPQLADVDGYRPTTFDYDPPAGSKDPRGGTPPGKSE
FT                   WVDVFRKSIPEFRKRAAADPRVPDAASLADRFADDFSAALDRIHAGDHADLFEGQPTVL
FT                   KMCRLRDETLRSLGFTDCFKDVKATENERALTVLPAVLAEIDAIADAKDRLLALIQGAF
FT                   AGNIFDLGAAASAKLHEDGGGDFRSTRARLKSRPWLVDDFDSLHQAWTANGATGGELAS
FT                   TWRKCVMFVDNSGADVVLGMLPIARELARRGCKVVLAANEVASINDVTAAELEDLLPRV
FT                   AELDETFAEAVKCGAIAVCSSGSDLPVIDLRRVSKRLAAVVDDADFVILEGMGRAIETN
FT                   LEAAFDCDALRIGMVKHPEVAQCLGGELYDCVCRFEAAGYI"
     atggcgacga cagatgaatt cgtgccgctg cctcagctcg ccgacgtgga cgggtacagg        60
     cccaccacgt tcgactacga tccacccgcg ggtagcaagg acccgagggg cgggaccccc       120
     cccggcaagt ccgagtgggt cgacgttttc cgcaaatcga ttcccgaatt tcggaagcgc       180
     gccgcggccg acccgcgcgt cccggacgcc gcatccctcg cggaccggtt cgcggacgat       240
     ttctcggcgg cgctcgatcg catccacgcg ggcgaccatg cggatctgtt cgagggccaa       300
     cccacggtgc tgaagatgtg caggctgcgg gacgagacgc tccgatcgct cgggttcacc       360
     gattgcttca aggatgtcaa ggcgacggag aacgagcgtg cgctgacagt cttaccggcc       420
     gtcctggctg agatcgatgc catcgccgat gcgaaggacc gacttctcgc gctaatacag       480
     ggcgcgttcg cgggtaacat cttcgacctc ggcgcggcgg cgtccgcgaa gctgcacgag       540
     gacggcggcg gagactttcg gtccacgcgg gccaggctca agtcgaggcc gtggctggtg       600
     gacgatttcg actcgctgca ccaagcctgg accgcgaacg gagccaccgg gggagagctc       660
     gcgtccacgt ggagaaagtg cgtcatgttc gtcgacaact cgggggcgga tgtcgtgctg       720
     gggatgctgc ccatcgcgcg cgagctcgcg cgacggggat gcaaagtcgt gctcgccgcg       780
     aacgaagttg cgagcatcaa cgacgtcacc gccgccgagc tcgaggatct cctcccccgc       840
     gtggctgagc tggacgaaac gttcgccgag gcggtcaagt gcggggccat cgcggtgtgc       900
     tcgagcggga gcgacctccc ggtgatcgat ttgagaaggg tgtccaagcg tttggcggcg       960
     gtggtggatg acgcggattt cgtgatcctc gagggaatgg gccgcgccat cgagacaaat      1020
     ctcgaggcgg cgttcgactg cgacgcgctc aggattggca tggtgaaaca tccggaggtg      1080
     gcgcagtgct tggggggcga gctgtacgac tgcgtgtgca ggttcgaggc tgcggggtat      1140
     atatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page