(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE453

MICSR_1.PE453        Location/Qualifiers
FT   CDS_pept        join(complement(900067..900165),complement(894300..899870))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637371"
FT                   /orf_name="MICPUN_57037"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62245.1"
FT                   /db_xref="InterPro:IPR022113"
FT                   /db_xref="UniParc:UPI000199ABC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y0"
FT                   /transl_table=1
FT                   /translation="MRGDGRRSRAPWPLLIVLLLFLSWTGPTARAEKDPDQVAQGELSA
FT                   SAYAPSSVGADGQPAAAPPPKPDPGGRGAEIETYKDHDDFGKILYPPPRLPLGPQWAPS
FT                   VSIVPTELKFVETPLCQPTTHVIHVYNMDQRETFKILSLTTDAVYMQPVDFRSVEVPPG
FT                   RGRQLKVAFLPRSLGGSHGSFRLLTSKGSIVISARGVGVESPYKLQPLVGAKVPSGVPF
FT                   MWRLELFNPHSSTVKLVEALSSDHTISLGPPSVEDLESQNKFDEEDKAIMEKANNSGRG
FT                   GVRSFPSTIWELPSKSSKVVLSVKLLAAHAGRHEGSIKLVLNRTKGETYDINDVMERHE
FT                   LHVPVQFDAAHGGVFRSPDQIDFGIATRRLDRLRQTVTLFNSGAEPIRVMDVSLRPADP
FT                   SLRVKYTKGYILQPYTEEPVIQLVYSGKLEGVRMGTLLIRTSNSNIPIEVPYRAKIQHG
FT                   KLSWNEAEMSFLSPATGRKPFPAVSNTVRVLNNFRTPIAFHAVRVVNRPPRSNKNTEHT
FT                   EAQAQIAQGNEKPSEIAGALSTADDEEVCCFEVKDFTGGQVVSPGHPLAPFTIEYTPQD
FT                   KNVVFTATLELDTNLTTLEIPIEVHHGQLTCFDADQAEMRAKAAAEAAAMIAAAVVTKD
FT                   AAGNAPRDSDPAAEDSGDAVPCAVLAEGRKATRVGDDISQMGLIDFGVVGVPAERYRRV
FT                   AVYNPNPMPLTIKSVESSVRSVSVTRVEVSGSSLKTPISHVAPGSLLSTLHQTSHKPPP
FT                   PPPRCMTAEGKNVACKQEFWSVQHKGGSGAVIIPPLHIATVHVLAAPEREETAPKGALT
FT                   FYLDNGRQLIAPVAIKALKGTISVSGMNTPVVELPPTFPGRPILAPLKLRNDFRDVVTV
FT                   IGSRSTSPTFSLDLFAQKLKPGRDTTAGQVAFDPAHLPRQYAYTSLGRVRRKPESEKVI
FT                   DKRRSMFAAMLGADVDDSRTKTKAKTLYPDDVDELRRMTDAWRAVAADHGGHADAGAGA
FT                   FVTQTATVLLKTDAVDPFPIEVRSRLLRPSIFSVVEEEEEEPPKKTMDARFQYSTSKSK
FT                   PKSKGEGQRVLNKDGVVDFGSVQLDRRSPRHRVIATNPLGNQVVCVRIMPFVAAAEKSI
FT                   AEMEGDVDAATISAANLHVAGEYDPPGATGFVLEGGDISMKRKTGAGKGAAALVSDGRD
FT                   TACLEPGESVDLGLLSFKPKEVRKYHAHMCVRNNFTTLECATLSGSADAVKVYVAKKPR
FT                   GTQVVTDVGFRLARIGLGGADMLMQTVHVVNRGSVAVEVAKPYVGAFACGGDGSVGGYT
FT                   VQPCKPFTLPPGGSKQLTVACFTDKAAQAAKYARGVAGVWTALTMEVSSPDGVKTTLVA
FT                   NLHASDGIVTGAYAAGEMARSGPRSLIAWLATMCSGGAACWLFYANRASLQGAYERRKK
FT                   AAAAAAATRQEAVVAAVAAAAVATNGKKAKRRGSQDIGSPASPGATKSGSPKSPIVSSS
FT                   MDTESSLGSSPEKTESVLAKAPEPETSGMDSASGSSPALSPKISSSKLRDEKKPADKKS
FT                   DKEEAEVEKKEAAKSSSKPSSPVSPARKEKANGTDSKIKSVPAPRTAPSTESANGKVSP
FT                   KTTVSPKTSPANSFKQPAEKTSDKAKVIPKPKGGAAPNPFKQPKQQQERLREEQPATSQ
FT                   APRPEQLPTPNVTFAGKPIRTKASFGNEAGDDWITPPKPAAASPTYSEQSLLSPTGLAA
FT                   EATATAAGLSVLSSPYGHDIFASAPSSMQQQHQQPPLPPGPPPSMQHQQPPLPAGPRPP
FT                   NLRQDGTQQMTQQPLGGFAPVGLPGLGSIGGGASGYNMWADHFSQLGQAAAKPSNLATP
FT                   DDVRRLSESAGGSFFGGGLASATDGDALEPDGVGGGDGGGWGLWGSSHKPANSDLDDNE
FT                   WEQKNLDLLNDLELD"
     atgaggggtg atgggagacg atcgcgcgcg ccgtggccgc tgctgatcgt cctgctgctg        60
     ttcctgtcgt ggacgggacc gacggcgcgg gcggagaagg atcccgatca ggtggcccaa       120
     ggtgagttga gcgcgagcgc gtacgcgcct tcgtcggtag gcgccgatgg gcagccggcg       180
     gcggcgccgc cgccgaagcc tgatcctggc ggccgcggcg cggagatcga gacatacaag       240
     gatcacgacg atttcgggaa gatcctgtat cccccgcctc gcttgccact cggcccgcag       300
     tgggcgccct ccgtatcaat cgtcccgacc gaactcaagt ttgtcgagac gcctctgtgc       360
     cagcccacga cgcacgtgat tcacgtgtac aacatggacc agcgcgagac cttcaagatc       420
     ttgagtttga ccacagacgc ggtgtacatg cagcccgtgg actttcgatc ggtggaggtg       480
     cccccggggc ggggtcgcca gctgaaggtt gcgtttctcc cgcggtcgct cggcggatct       540
     cacggttcgt tccggctgct gacaagcaag ggatccatcg tgatctccgc gcggggagtg       600
     ggcgttgagt caccgtacaa gcttcagccg ctggtgggcg ccaaggtgcc gagcggggtg       660
     ccgttcatgt ggcgcctcga gctgttcaac ccgcactcat cgacggtcaa gctggtggag       720
     gcgctctcct ccgatcacac catctcgctc gggccgccca gcgtagagga tctcgagtcg       780
     cagaataagt tcgacgagga ggacaaggct atcatggaga aggcgaacaa ctcgggccgg       840
     ggcggggtca ggagtttccc cagcaccatc tgggagctgc cgtcgaagag cagcaaggtt       900
     gtcctctccg tgaagctcct cgccgcgcac gccggtcgcc acgagggatc catcaagctt       960
     gtgctcaacc ggacaaaggg cgaaacgtac gatataaacg acgtcatgga gaggcacgag      1020
     ctgcacgtgc cggtgcagtt cgacgcggca cacggcggcg tgttcaggtc cccggaccag      1080
     atcgatttcg gcattgcgac gaggaggctg gacaggctgc ggcagacggt gacgctcttc      1140
     aatagcggag cggagcctat cagagtgatg gacgtctcgc ttcgtcccgc ggatccgtcc      1200
     ctgcgagtca agtacacgaa ggggtacatc ctgcagccgt acaccgaaga gcccgtgatt      1260
     cagctcgtct actcggggaa gttggagggt gtccgcatgg gaacgctcct gatcaggacc      1320
     agcaactcga acattcccat cgaggtgccg tacagggcca agattcagca cggtaaactg      1380
     agctggaacg aagcggagat gtcgttcctg tcgcccgcga ctggacgcaa gcccttcccg      1440
     gctgtctcca acacggtgcg tgtcttgaac aacttcagga ccccgatcgc tttccacgcc      1500
     gttcgcgtcg tgaatcgacc gccgaggtcc aacaagaaca cggagcacac cgaggcgcag      1560
     gctcagattg cccagggtaa cgagaagccc tccgagatcg ccggcgcgtt gtcgaccgcc      1620
     gatgacgagg aggtttgctg ctttgaggtg aaggacttca cgggtgggca ggtcgtcagc      1680
     cccggccatc ccctcgcgcc tttcactatc gagtacacgc cgcaggacaa gaacgtcgtc      1740
     ttcaccgcga cgctcgagct tgacaccaac cttactacgc tggagatacc catcgaggtg      1800
     caccacggac agctcacctg cttcgacgcg gaccaagccg agatgcgggc caaggcggcg      1860
     gcggaagcgg cggccatgat tgccgccgcc gtggtcacaa aggacgcggc cggtaacgca      1920
     ccgcgggata gcgaccccgc ggccgaggac tcgggagacg cggtgccgtg cgcggtgctc      1980
     gctgaaggga ggaaagcgac ccgggttggc gacgacatat cgcagatggg tctcatcgac      2040
     tttggcgtgg tgggcgtccc ggcggagcgc tacaggcgcg tcgccgttta caatcccaac      2100
     ccgatgcccc tgacgatcaa gtccgtggag tccagcgtca gatccgtgtc cgtgacccga      2160
     gtcgaggtct cgggcagcag cctcaagaca cccatctccc acgtggcgcc ggggtcgctc      2220
     ctgtccacct tgcaccagac ttctcacaag ccccccccgc cgccgccgcg gtgcatgacg      2280
     gcggagggca agaacgtcgc gtgcaaacag gagttctggt cggtgcagca caagggcggc      2340
     agcggcgcgg tgattatacc cccgctgcac atcgccactg tgcacgtgct cgccgccccc      2400
     gagcgggagg agacggcgcc aaagggggcg ctgacttttt acctcgacaa cggtcggcag      2460
     ctcatcgcgc ccgtcgcaat caaggctctg aaggggacca tcagcgtctc ggggatgaac      2520
     acgcccgtcg tggagctacc gcccacgttc cctgggcggc ccatccttgc gccgctcaag      2580
     ctcaggaacg acttcaggga cgtcgtcacg gtgatcggat cgcgatccac gtcgccgaca      2640
     ttttctctcg acctcttcgc gcaaaagctc aagcccggcc gggatacgac cgcgggccag      2700
     gtggcgttcg atcctgcgca tctcccgcgc cagtacgcgt acaccagcct cggccgcgtg      2760
     cgtcgcaagc ccgagtctga gaaagttatc gataagcgaa ggtctatgtt tgctgcgatg      2820
     cttggcgcgg atgttgacga ttcaaggaca aagacgaagg ctaagactct gtaccccgac      2880
     gacgtagacg aacttcgtag gatgacggac gcgtggcgcg cggtggctgc agaccacggg      2940
     ggccacgccg acgctggagc cggcgctttc gtgacccaga cggctaccgt gctgctaaag      3000
     acggatgctg tcgacccctt cccaatcgag gtcaggtcgc gactgctcag gccctccatc      3060
     ttctctgtcg tcgaggaaga ggaagaagag ccgccgaaga agaccatgga tgcgcgcttc      3120
     cagtattcca cttcgaagtc gaagccaaag agcaagggtg agggccaaag ggtcctgaac      3180
     aaggacggcg tggtcgattt tggctcggtg cagctcgacc gcaggagccc ccgccaccgc      3240
     gtcatcgcga caaacccgct gggcaatcag gtcgtctgcg ttcgcatcat gcccttcgtc      3300
     gccgcggcgg agaaatcgat cgcggagatg gagggcgacg tcgatgcggc tacgatatcg      3360
     gccgctaacc tgcacgtcgc gggtgagtac gacccgccag gggccaccgg ctttgtcctt      3420
     gagggcggcg acatctccat gaaacgaaag acgggtgcgg gcaagggtgc cgccgcgctg      3480
     gtgagcgacg ggcgggatac cgcctgcctc gaacccggcg agtccgtcga cctcggtttg      3540
     ctctccttca agcccaagga ggttcgaaag taccacgcgc acatgtgcgt caggaacaac      3600
     tttaccacgc tcgagtgcgc cactctctcc gggtcggcgg atgcggtcaa ggtttacgtc      3660
     gcgaagaagc cgaggggcac gcaggtcgtc accgacgtcg ggttcaggct cgcgaggatc      3720
     gggcttggcg gcgcggatat gctgatgcag actgtgcacg ttgttaaccg cggatccgtc      3780
     gccgtggagg ttgcgaagcc gtacgtcgga gcctttgcgt gcggcggcga cggcagcgtc      3840
     ggaggataca cggtgcagcc gtgcaaaccg ttcaccctgc cccccggcgg gagcaaacag      3900
     ctcaccgtcg cgtgcttcac ggataaggct gcgcaggcgg ccaagtacgc tcgcggcgtc      3960
     gcgggcgtgt ggaccgcgct caccatggag gtgtcgtccc ccgacggggt caagactacg      4020
     ctcgtcgcca atcttcacgc gtcggatggg attgtcaccg gagcgtacgc ggctggcgag      4080
     atggcgcgat cgggaccccg gtcgctcatc gcgtggctgg cgacgatgtg ctcgggcggc      4140
     gccgcgtgct ggctcttcta cgccaaccgc gcctcgctcc agggtgcgta cgaacgacgc      4200
     aagaaggcgg ccgcggcggc ggctgctacg cggcaggagg cggttgtggc ggctgtcgca      4260
     gccgcggctg tcgcgaccaa cggcaaaaag gcgaagaggc gcgggtcgca ggacatcgga      4320
     agccccgcgt ccccgggcgc gaccaagagc ggaagtccca agtctccgat cgtctcctcc      4380
     tcgatggaca ccgagtccag cctcgggtcc agcccggaga agactgagtc ggtcctcgcg      4440
     aaggctcccg agccggaaac ctccggcatg gactccgcct ccggttcctc tccggcgcta      4500
     tcccccaaga tctcctcgtc aaaactccga gacgagaaga agccggcgga taagaagtct      4560
     gacaaggagg aggcagaggt ggagaagaag gaggcggcca agagctcgag caagccctcg      4620
     tctcccgtct cccccgccag gaaggagaag gcaaacggaa cagattcgaa gatcaagtct      4680
     gttcccgccc cccgaaccgc cccgtcgacg gagagcgcca atggcaaggt gtctcccaag      4740
     acgaccgtct cgccgaagac gtcacccgcc aactcgttca agcagccggc ggaaaagacg      4800
     tccgacaagg ccaaggtgat acccaaaccc aaggggggcg cggctcccaa cccgttcaag      4860
     cagcccaagc agcagcagga gcggctgcgg gaggagcaac ccgcgacgtc gcaggccccg      4920
     aggccggagc agcttcccac gccgaacgtc acgttcgccg gcaagcccat acgcaccaag      4980
     gcgtccttcg ggaacgaggc gggcgacgac tggatcacgc cgcccaagcc ggcggcggcg      5040
     tctccgacgt actctgagca atcgctcctg tccccaaccg gactcgccgc cgaggcgacg      5100
     gccacggcgg cggggctctc ggtgctgtcg tcgccgtacg ggcacgatat cttcgccagc      5160
     gcgccgtctt cgatgcagca gcagcaccag cagccgcccc ttccgccggg cccgccgcct      5220
     tcgatgcagc accagcagcc gccccttccc gcgggcccga ggccgccgaa cctccgacag      5280
     gacggcacgc agcagatgac gcaacagccg ctcggcggtt tcgccccggt gggtttgccc      5340
     ggcctcggat ccatcggcgg cggcgcgtcc ggctataaca tgtgggccga tcacttctcg      5400
     cagctgggcc aagccgcggc caagccgagc aacttggcga ccccagacga cgttcgaagg      5460
     ctgtccgaat ccgccggcgg atcgtttttc ggcggaggcc tcgcgtcggc gactgacggc      5520
     gacgcgctgg agcccgacgg cgtcgggggc ggagacggag gcgggtgggg gctgtggggc      5580
     tcgtcgcaca aacccgcgaa cagcgatctg gacgataacg agtgggagca gaagaacctc      5640
     gacctgctca acgacctgga actggactga                                       5670
//

If you have problems or comments...

PBIL Back to PBIL home page