(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE454

MICSR_1.PE454        Location/Qualifiers
FT   CDS_pept        900514..901929
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637372"
FT                   /orf_name="MICPUN_57038"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61821.1"
FT                   /db_xref="UniParc:UPI000199ABC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y1"
FT                   /transl_table=1
FT                   /translation="MAHPAIASLGAGASSVVSSSARVARRQRAPVRVSGSASDRRAARV
FT                   GESERARQRRGRGIEAVAASTGVKVDRFGASVAADFPPRFERPSSPSCSVGLELDEDFL
FT                   DARDDAPDENEVTTTRQCLDSRKVALGSLALFVLVGGVAAIHPDPALAREVTLELPDFD
FT                   IPDFEVPDIPTTPMEFLEVVTTNPYAAVAASVAAYLVIPKAAELLVKYVLVPALVLLVA
FT                   YEASQNPDETIALVASAINQARDHPTVTSGIILAILALVLSPYILVAAGVGLIVSGVQL
FT                   LPEQLKPVLPAPVREIETQIEELQRAVDPGVKRARALGSQAKARGEKLRQEADAQKARL
FT                   EAERDRRLREQAEAAAQRIEDTRAALVAPVVTAQKAAEEAAKETLERAQDVTEAVAEAG
FT                   EGAGQTVKCTSYPTPQERSSCVDRQREERRQRESKRTEELREKASRLRANSAERERPVP
FT                   DVGKALLGSGESS"
     atggcgcacc ccgccatcgc gagcctcggc gcgggggcct cgtcggtcgt ctcgagctcc        60
     gcgcgggtcg ctcgtaggca gcgcgcgccg gttcgtgtga gcgggtccgc ctccgatcgt       120
     cgcgcagcgc gcgtcgggga atcggagcgc gcgcgccagc ggagagggag aggcatcgag       180
     gccgtcgcgg cgtcgacggg cgtgaaggtc gaccgcttcg gcgcgtccgt cgcggccgat       240
     ttcccgccgc gcttcgagcg accgtcgagc ccgtcgtgtt ccgtcggcct cgagctcgat       300
     gaggatttcc tcgacgcacg cgacgacgcc cccgatgaga acgaagtgac cacgacgcgt       360
     cagtgcctgg actcccgcaa ggtcgccctc ggctcgctcg cgctcttcgt tctcgtcggt       420
     ggcgtcgccg cgatccaccc cgatcccgcg ctcgccaggg aggtcaccct ggagctgccg       480
     gacttcgaca tccccgactt tgaagtcccg gacattccca cgacgccgat ggagttcctc       540
     gaggtcgtca ccacgaaccc gtacgccgcc gtcgcggcgt ccgtcgcggc gtaccttgtc       600
     atacccaaag ccgcggagct gctggtgaag tacgtgctgg ttcccgcact cgtgctgctg       660
     gtcgcttacg aggcttcgca gaacccggat gagaccatcg cgctcgtcgc atcggcgatt       720
     aaccaggcgc gggaccaccc cacggtcacc tcggggatca tcctcgcgat cctggcgctg       780
     gtgctgtcgc cgtacatcct cgtcgccgcg ggcgtcgggc tgatcgtgtc tggcgtgcag       840
     ctgctccccg aacagctcaa gcccgtgttg ccggcgccgg tgagggagat tgagacccag       900
     atcgaggagc ttcagcgcgc ggtggacccc ggggtcaagc gagccagggc gctgggttcg       960
     caggcgaagg cgcggggcga gaagctgcgg caggaggcgg acgcgcagaa ggcgaggctg      1020
     gaggctgaga gggacaggcg cctcagggaa caggcggagg ctgctgctca gaggatcgag      1080
     gacacgaggg cggcgctggt cgcgccggtg gtgacggcgc agaaagccgc ggaggaggcg      1140
     gcgaaggaga cgctcgagcg cgcgcaggac gtcaccgagg cggtggcgga ggcgggcgag      1200
     ggcgcggggc agacggtgaa gtgcacgagc tatccgacgc cgcaggagcg gagcagttgc      1260
     gtggacaggc agcgagagga gcggcgccag cgggagagca agaggaccga ggagcttcgc      1320
     gagaaggcgt ccaggctgag agcgaactcg gcggagaggg aacggccggt gccggacgtg      1380
     ggtaaggcgc tcctcggaag cggggagtcc tcttaa                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page