(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE455

MICSR_1.PE455        Location/Qualifiers
FT   CDS_pept        902562..902777
FT                   /codon_start=1
FT                   /gene_family="HOG000237835" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637373"
FT                   /orf_name="MICPUN_57039"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61822.1"
FT                   /db_xref="HOGENOM:HBG444320"
FT                   /db_xref="UniParc:UPI000199ABC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y2"
FT                   /transl_table=1
FT                   /translation="MSSAGLVFYREVCRAIRKLPKDTQSYYRVVAREKVVAHRDEDEPE
FT                   RIGKIIQRSREDVAWVLKKYSPTKDA"
     atgtcatctg ctgggctcgt gttctatcgc gaggtctgcc gggcgatcag gaagctccct        60
     aaggacacgc agagctacta ccgcgtcgtg gcaagagaga aggttgtggc tcatcgcgac       120
     gaagacgagc ccgagaggat cggcaagatc atccaacgga gccgggagga cgtggcgtgg       180
     gtgctgaaga agtactcgcc gacgaaggac gcgtga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page