(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE456

MICSR_1.PE456        Location/Qualifiers
FT   CDS_pept        902831..905368
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637374"
FT                   /orf_name="MICPUN_99528"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61823.1"
FT                   /db_xref="InterPro:IPR019321"
FT                   /db_xref="UniParc:UPI000199ABC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y3"
FT                   /transl_table=1
FT                   /translation="MEAFLNPCVRSDGERLDPSLSPAPSLLAEDGRGVLYALGADGVIR
FT                   ACPARLLNAAARGSIADDALPTRVFKPEPPIDFEPRTISVSPSGHFAAVGGLRHDASAG
FT                   SGSIPPSSALAIVSLRTGGDRSGFEALEDGAPGCRCVPLLDDDFDRHPSMRPLRAAWHP
FT                   NSDGHLCVLLSDGTLHVFDAAVGPVAEQAFRLDPWGRGSRPGPYPLRPEIVDFAFAPPH
FT                   GWGALSLVLLGREGDVYVMCPFAPWGARYPRVTLESLQPPDENSEVWLATTFPTLRRNG
FT                   RGADNEDDDDGYDDDAGGGGGVVPSDDDDDDAGGGGGGAPSDDDDAFAGPTVAARPARI
FT                   EGVATALRGPLPLGTDPVDGDGDGGVIGRGAVARSLAAAPFAAGEGGGALLAVAHQRVV
FT                   ADERDERAPNEGRVSATLDVLILPQEPSPAWAALSEEDEAAAYEAAACDGGPVLTLAPI
FT                   AADDDDGSLQPLLAIDRVELASGEPTLRRPKTSVAAAQNELAPFVSVVWDPSCRDRVFC
FT                   CAGGAVHGVTLTWLAAVEGAVDEEEEGEKSGSELSLPTVVTLMDSPEVLLGVAPCGDPL
FT                   AEGLLLAVDATGAAYGLRPAPPLPEGIDAGNEDEAIDSAAASALAGGAEASAELRALAA
FT                   GPPGPPPAPPAGAAALKPGTIEGNAALAAAAIALKERHLRYAHRVHAATKRHSLRLGAE
FT                   IKRQRVEAKVIREGLEAVLARKEILAAKIERSVANHEEIRERLRKLAEAERSLPHPLTR
FT                   AESAFKTTLQANADDLPLLEAKLEELKRRCEAIGEDFATIGALAAGDGDVFERLAASDP
FT                   AIAAEIELQDAATKANLERVKEIELAVGPLDDF"
     atggaggctt tcctgaaccc ctgcgttcgg agcgacggcg aacggctgga cccatccctc        60
     tcgccggcgc cgagcctgct ggcggaggac gggcgagggg ttctctacgc gctgggcgcc       120
     gacggcgtga tccgcgcgtg ccccgcgcgc ctcctcaacg ctgccgcgcg cgggtccatc       180
     gccgatgacg cgctccccac gcgcgtcttc aagcccgagc ccccgatcga cttcgagcca       240
     cgcacgatct cggtttcccc ctcggggcac ttcgccgcgg tgggcggcct gaggcacgac       300
     gcatccgcgg gatccgggtc catcccaccg tcctccgcgc tcgccatcgt ttcgttgagg       360
     acgggcggcg atcggtccgg gttcgaagcg ttggaagacg gcgcgcccgg gtgccgatgc       420
     gttccgctgc tggacgacga ctttgacagg cacccgtcta tgcgcccgct ccgagccgcg       480
     tggcacccta acagcgacgg gcacctgtgc gtgctcctct ccgacggcac gttgcacgtg       540
     ttcgacgccg ccgtgggacc cgtcgcggag caggccttca ggctggatcc gtggggccgg       600
     ggatcccgac cggggccgta cccgcttcga cccgaaattg tcgattttgc ctttgcgccg       660
     ccgcacggtt ggggcgcgct gtcgctcgtg ttgctggggc gggaggggga cgtgtacgtg       720
     atgtgcccgt tcgcgccgtg gggggcgagg tacccgcggg tcaccctgga gagcctgcaa       780
     ccgccggatg aaaactcgga ggtttggctg gcgacgacgt tcccgacgct tcgcagaaat       840
     gggagggggg cggacaacga agacgacgac gacgggtacg acgacgacgc gggcggcggc       900
     ggcggcgtcg tgccgagcga cgacgacgac gacgacgcgg gcggcggcgg cggcggggcg       960
     ccgagcgacg acgacgacgc cttcgcggga cccaccgtcg ccgccagacc cgctcgaatt      1020
     gagggcgtcg cgacggcgct ccgggggccc ctaccgctcg gcaccgaccc ggtggacggc      1080
     gacggcgacg gcggcgtgat cggtcgcggc gcggtggcgc gctcgctcgc tgcggcgccc      1140
     ttcgccgcgg gcgagggcgg cggcgcgctc ctggcggtgg cgcatcagag ggtggtcgcg      1200
     gatgagcggg atgagcgggc gccgaacgag gggcgcgtct ccgccacgct ggacgtgctc      1260
     atcctgccgc aggaaccgtc cccggcgtgg gccgcgctca gcgaggagga cgaggcggcc      1320
     gcgtacgagg cggccgcgtg cgacggcggg cccgtgttga ccctcgcgcc catcgccgcg      1380
     gacgacgacg acggatcgct ccagccgttg ctggccatcg accgagtcga gctcgcgagc      1440
     ggcgagccga cgcttcgaag gccgaagacc tccgtcgcgg cggcgcagaa cgagctcgca      1500
     ccgttcgtgt cggtcgtgtg ggacccgtcg tgccgcgaca gggtgttctg ctgcgcgggc      1560
     ggtgcggttc acggcgtgac cctcacgtgg ctcgcagccg tcgagggcgc cgtggacgag      1620
     gaggaggagg gtgaaaaatc cggcagcgag ctgtcgctgc ccaccgtcgt cacgctcatg      1680
     gattcgcccg aggtgctcct gggcgtggcg ccgtgcgggg atccgctcgc ggagggtctc      1740
     ctcctggcgg tggacgcgac gggcgccgcg tacggtttgc gccccgctcc gccgcttccc      1800
     gagggaatcg acgcggggaa cgaagacgag gcgatcgact ccgcggcggc gtctgcgctc      1860
     gcgggcggcg cggaggcgag cgccgagctt cgagcgctgg cggcgggtcc tcccggcccg      1920
     cctcccgcac ccccggcggg cgcggcggcg ctcaagccgg gcacgattga gggcaacgcg      1980
     gcgctcgccg cggcggctat cgcgctcaag gagaggcact tgcggtacgc gcatcgagtc      2040
     cacgcggcga ccaaacggca cagcctgcgc ctcggcgcgg agatcaagcg gcagcgagtg      2100
     gaggccaagg tcattcgcga gggcctggag gctgtgctcg cgcgtaagga gatcttagcc      2160
     gcgaagattg agcgtagcgt cgcgaatcat gaggaaattc gcgagcgact caggaaactg      2220
     gcagaggctg agcgttcgct gccccacccg ctcacgcgcg cggagtctgc gttcaagacc      2280
     acgctgcagg ctaacgcgga cgacctaccg ctcctggagg cgaagctcga ggagctcaag      2340
     aggcggtgcg aggcgattgg ggaggatttc gcaacaatcg gcgcgctggc ggctggcgac      2400
     ggggacgtgt tcgagaggct cgcggcgtcg gacccggcga tcgccgcgga aattgagctg      2460
     caggacgccg cgacaaaggc gaacctggaa agggtgaaag agatcgagct agcggtcggt      2520
     ccactcgatg acttctaa                                                    2538
//

If you have problems or comments...

PBIL Back to PBIL home page