(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE457

MICSR_1.PE457        Location/Qualifiers
FT   CDS_pept        complement(905400..908927)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637375"
FT                   /orf_name="MICPUN_99529"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62246.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199AC3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y4"
FT                   /transl_table=1
FT                   /translation="MRSTVWREVAESPNLTGIAGPRVRFQCLDANHKHVVLGANTGSLY
FT                   VFARTRADGPSPFGPDADAPEGPLRFMTVVSPPRQPSDDAAKDDPADDARTPQSAFASR
FT                   SRGVSPAIRRIKLSPRGDRCAIAYATGVLNVVEFRPGVERRGGSPKVIVQIPKAHASAD
FT                   VTWLEWSPDGDRLLSGDDKGVVGVTEFANNSVVANTLSLGSAVAQASFSRSGLMAALCT
FT                   NEAVDLLSVPTGVHPKVGTKPREGPYGGCFHVLARDAAPDGALVSKQPESEWMLAARPG
FT                   RRLWVAEAWLEGGTQGEPRSAVAATLKPDVPKGSRAPGAPEPRPGAKSRKWEFGRLHPL
FT                   GRTCVLSVAERALAVVEVPGGSLLEWCPLGEPGSVGIAAGVASAAAVDARAFLLAAPEH
FT                   GGGVWCLEAPATEAALVACVADVAAVAVASRARDGAGKDAGLAETLHAVSLATKLRVPE
FT                   TRLLEDARALVRDVAARRAVGDGGKVLDDEDDDFVDIDAELASAVEAYERFYAEAVGDA
FT                   PPPPPRPSLDERTTASSPPRPAAALSRSSSFASSAGASLSRGDSGLDATIVGAGEFPAA
FT                   ESGKFFFYNPNANAGERKERKSDKEEKKKKKSAKVVDVGDGTAPVDAPRPKRDKPKKSP
FT                   PAPEPIAETSPTNEDKKTAADMGSIVARLEEDRDDYLAAVKALSDLGEAPPVSPPPFLH
FT                   WTEYREIPALVEVGSAAAAAKSTTGKRREALRRARERRIDAAAVAARALRLSRRSLDAS
FT                   PLIPALRRWRLARAECDEIADEIDDVVEFGGGDETHATRQLSDSTQLAREDMFEALALV
FT                   ERELDVAVVELRLVGAEPAERRVGEAAARVFAEADAAEAAARTTKGTIVEPADDKAPKS
FT                   VDEPFDGDLGALAGSLVGALSLGEEERVERILRAIPPEDGEIVAVESFRRALVDLLSRP
FT                   DSAQPLESLESVTTVVAAALGAENALKALEVAVEDEAIEKKIGCDALETFAGNVFADAI
FT                   TCVTLDLVAAVGDERDRGRAASKILRPLEARVSDPPPSPVGRFPQLRAAIAAEASLKAS
FT                   PGDDAAMRRLPFVKKERGRWELAVTHTKPIEPTLEDPTGGWGVRVPLSTACCARCALPL
FT                   REIRWSGDAGQSSLGRLVTFPCGHTLHECCAIEDACVECAASNAKPLRSPAFITLSAAI
FT                   NAELESLRL"
     atgagatcga cggtttggcg agaggtggcg gagtcgccca acctgacggg catcgccggt        60
     ccgcgggttc ggttccagtg cctcgacgcc aaccacaagc acgtcgtcct cggcgccaac       120
     accggtagcc tctacgtctt cgccaggacc cgcgccgatg gcccgagccc gttcggcccc       180
     gacgcggacg cgcccgaggg accgctgcga ttcatgaccg tcgtctcgcc cccgaggcag       240
     ccgtccgacg acgccgccaa ggacgatccc gcggacgacg cgaggacgcc ccagtcagcg       300
     ttcgcgtcgc gctcgagggg cgtatccccc gcgatacggc gcatcaagct atcccccaga       360
     ggcgataggt gcgccatcgc gtacgccacc ggggtgctca acgtggtcga gttccggccc       420
     ggcgtcgaac gcaggggcgg atctcccaag gtgatcgtgc agatccccaa ggcgcacgca       480
     tccgccgacg tcacgtggct ggagtggtcc cccgacggcg ataggctcct cagcggcgac       540
     gacaaaggcg tggtgggcgt gacggaattc gcgaacaatt ccgtcgtcgc caacaccctc       600
     tcgcttggat ccgccgtggc gcaggcgtcc ttctcccggt ccgggctgat ggcggcgctg       660
     tgcaccaacg aggcggtgga tctgctatcc gtacccacgg gcgtccaccc gaaggtgggc       720
     actaagccca gggagggacc ttacggcggg tgtttccacg tcctggcccg cgacgccgct       780
     cccgacggag cgctggtgtc gaaacaaccc gagagcgagt ggatgctcgc ggcgaggccg       840
     gggagacgac tgtgggtcgc ggaggcgtgg ctagagggcg gaacccaggg ggaaccgcgg       900
     agcgccgtcg ccgcgacgct caagccggac gtgcccaagg gttccagggc gcccggagcc       960
     cccgagccca ggcccggggc caagtcgcgc aagtgggagt tcggccggct gcaccccctc      1020
     gggcgcacgt gcgtcctctc cgtcgccgag cgcgcgctcg cggtggtgga ggtaccgggc      1080
     gggagcctgc tggagtggtg cccgctgggt gagccggggt ccgtcgggat cgccgccggg      1140
     gtggcgtcgg cggcggcggt tgacgcgagg gcgttccttc tcgccgcgcc cgagcacggc      1200
     ggcggcgtct ggtgcctcga agcacccgcg acggaagccg cgctggtggc gtgcgtcgcg      1260
     gacgtcgcgg cggtggcggt ggcgagccgt gcgagggacg gtgccgggaa ggacgcgggg      1320
     ttggcggaga cgcttcacgc ggtttccctc gcgacgaagc ttcgggtgcc ggagaccagg      1380
     ctgctcgagg acgccagggc gctggtgcgg gacgtcgcgg cgcggagggc ggtgggcgac      1440
     ggtgggaagg tgttggacga tgaggatgat gatttcgtgg acatcgacgc ggagctcgcg      1500
     tccgccgtcg aggcttacga gcgcttctac gcggaggcgg tgggcgacgc cccgcccccg      1560
     ccgccgcggc cgagcctcga cgaacgaacg accgcatcgt caccgcccag gcccgcggcg      1620
     gcgctgagcc ggtcgtcgtc gtttgcgtcg tcggcggggg cgtcgctgtc gcgtggtgat      1680
     tccggattgg atgcgacgat tgtcggcgca ggggagtttc cggcggcgga gtcgggcaaa      1740
     ttcttcttct acaacccgaa cgccaatgcc ggcgagcgaa aggagagaaa gagcgacaag      1800
     gaggagaaaa agaagaaaaa gtcggcaaag gtggttgacg tcggcgacgg caccgcgcct      1860
     gtggacgcgc ccaggccaaa gcgagacaag ccgaagaaat ctccccccgc gccggagccc      1920
     atcgcagaga cgtctccgac aaatgaggac aagaagaccg cagcggacat gggctcgatc      1980
     gtcgcgcggc tcgaggagga ccgcgacgat tatctcgcgg cggttaaggc gctgagcgac      2040
     ctcggcgagg ccccgccggt gtcgccaccg ccgttcctgc actggacgga gtaccgagaa      2100
     attcccgcgc tggttgaggt cgggtccgcc gccgccgcgg ccaagtcgac caccggtaaa      2160
     cgtcgcgagg cgttgcgccg cgcgagggag cgtcgcatcg acgcagccgc ggtcgccgcg      2220
     cgcgccctca gactctcgcg tcggtccctc gacgcctcgc cgttgatccc ggctctcagg      2280
     cggtggcgat tggctcgcgc cgaatgcgac gaaatcgccg acgaaatcga tgacgtcgtc      2340
     gaatttggcg gcggggacga gacccacgcc acgcgacagc tgtccgactc cacccaactc      2400
     gcgcgcgagg atatgttcga ggcgttggcg ttggtggaga gggagttgga cgtcgccgtg      2460
     gtggagctca ggctcgtggg cgccgagccg gcggagcgta gggtcggcga ggcagccgcg      2520
     agggtcttcg ccgaggccga cgccgccgag gccgcggcga ggacgaccaa gggtacgatc      2580
     gtcgaacccg cggatgataa agcaccgaag agtgtggacg agccgttcga cggggatctc      2640
     ggtgcgctcg cgggctcgct cgtgggcgct ctgtccctcg gcgaggagga acgcgtggag      2700
     cggatcttaa gggcgatccc gcccgaggat ggcgagatcg tcgccgtcga atcattcaga      2760
     cgcgcgctcg tcgatttact cagcagaccc gactccgcgc agccgctgga atcgctcgag      2820
     tccgtcacca ccgtcgtcgc agccgcactg ggcgcggaga acgcgctaaa ggcgctcgag      2880
     gttgccgtcg aggacgaggc catcgagaag aaaattggct gcgacgctct ggagacgttc      2940
     gcgggcaacg ttttcgcgga tgcgatcacg tgcgtgaccc tcgacctcgt cgcagcggtc      3000
     ggcgacgagc gcgatcgcgg ccgggcggcg tccaagatcc tgcgaccgct ggaggcgcgc      3060
     gtgagcgatc cgcccccctc gccagttggc cggttcccac agcttcgagc agccatcgcc      3120
     gctgaggcga gcctgaaggc ctcccccggg gacgacgccg ccatgcgtcg cctgccgttc      3180
     gtcaaaaagg agaggggaag gtgggagctg gcggtgacgc acacgaaacc gatcgagccg      3240
     acactcgagg atccaaccgg cggttggggc gtgagggtgc cgctgtccac ggcgtgctgc      3300
     gccaggtgcg cccttcctct gcgggagatt cgatggagcg gagacgcggg gcaatcgtcg      3360
     ctcgggcggc tcgtgacgtt cccgtgcggt cacacgctgc acgagtgctg cgcgatcgag      3420
     gacgcgtgcg tggagtgcgc ggcgtcgaat gcaaagcccc ttcgatcccc cgcgtttatc      3480
     acgttgagcg cggcgatcaa cgccgagctt gagagccttc gattataa                   3528
//

If you have problems or comments...

PBIL Back to PBIL home page