(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE458

MICSR_1.PE458        Location/Qualifiers
FT   CDS_pept        join(complement(910257..910271),complement(910004..910082),
FT                   complement(909283..909617))
FT                   /codon_start=1
FT                   /gene_family="HOG000019803" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637376"
FT                   /orf_name="MICPUN_93705"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62247.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG518785"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniParc:UPI000199AC3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y5"
FT                   /transl_table=1
FT                   /translation="MATQSVQTFGRKKTAVAVVHCKAGKGLIRFNGAPIELIQPETLKF
FT                   KAMEPIILLGRQRFANLDLRIRVKGGGHVSQMYAVRQAIAKAIVAYYQKYVDEQSKKEL
FT                   KDALLTYDRTLLVADPRRMEPKKFGGRGARARFQKSYR"
     atggctaccc agtcggtcca gactttcggc cgcaagaaga ccgccgtcgc ggtggtccac        60
     tgcaaggcgg gcaagggtct tattcgcttc aacggcgccc ccattgagct catccagccc       120
     gagactctca agttcaaggc tatggagccc atcatcctcc tcggtcgcca gcgcttcgcg       180
     aacctcgacc ttcgcatccg cgtgaagggt ggcggtcacg tgtcccagat gtacgccgtg       240
     cgccaggcca tcgccaaggc catcgtcgcc tactaccaga agtacgtcga cgagcagagc       300
     aagaaggagc tcaaggatgc gctcctcacc tacgaccgca ccctcctcgt cgcggatccc       360
     cgccgcatgg agcccaagaa gttcggcggt cgcggcgcgc gcgctcgctt ccagaagtcc       420
     taccgttaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page