(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE459

MICSR_1.PE459        Location/Qualifiers
FT   CDS_pept        910598..913033
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637377"
FT                   /orf_name="MICPUN_99531"
FT                   /product="Glycosyltransferase family 60 protein "
FT                   /function="heat shock protein binding"
FT                   /function="transferase activity"
FT                   /protein_id="ACO61824.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021067"
FT                   /db_xref="UniParc:UPI000199AC40"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y6"
FT                   /transl_table=1
FT                   /translation="MAPATPNARPSFASSAGEPSDTPHVPGRNHARLVAEIAREFRPRL
FT                   DTEGFSAVRELGSQLRELGVESNDDAPAHTHKRCKMCGNVCHARMNSCSSCCLPFVDRG
FT                   SWEPATMPRPGGDVHSETDSDSDSDSDSDDETEVDHVTEPTAPAVNAASAMERRRRERR
FT                   AAAAVPSGGPVGGPVASDSADATTRPGWHDWFNRTGRLREAPTHERGLDPTLERSYAAL
FT                   GCAFGATEADVRIAYRKCVRRVHPDSGGSRKQLARVHDALEAIDRDAWSHGEGAAALRE
FT                   ALVASESEPVSTETGAKKPRVFVSLAVYRDPEGLHTLKDAFDRASDPSRIFAGVHWQHV
FT                   LAKPSGEEPVVDRLHPAQNMFTRQVEANLGKIQGDEDKVRYLEESMKQQGDNQRDLDEK
FT                   EARLHAKASLDATDGTKWEWAGHVRETRESWECAEGPCRARHMSMRLWGGEEYVLHADS
FT                   RTRFDHGWDDVLIAELERIQTLTNNPAVLTGVPLGYHMRMTPVDNPETYERVGYLPVYG
FT                   RDEEREHELSNLVVPLRRDRTDDAPSIAALGVCGFGDLLCYPAAVRLAPYDAADADEPP
FT                   LPAMLVNPSFVFAPAKALVADAPPDLHAPFLYLGEELITSARLWTKGWRTYLPRHCPLR
FT                   VCYDPRNRIDETREDKRRGAQLYDHPRSEAARGTWDQLEERYFMNLQSRRRVLQVIGAP
FT                   DPDSATRDPRDAVILKEPWAPGSVRPVSEFVKSLGVDFDEREISNTSRYAGLDRDALNM
FT                   THDTRAVKKRDTFAARTDATELGDDVLADDGLPLKWKNGSPLFGDLSAGYYERTERWS"
     atggcgcccg ccacgccgaa cgcgaggccc tcgttcgcct cctccgcggg cgaaccctcg        60
     gatactcccc acgtccctgg tcgcaaccac gcgcgcctcg tggcggagat cgcgcgcgag       120
     ttcaggccca ggctggacac cgagggcttc tccgcggtca gggagctcgg gtcgcagctc       180
     agggagctcg gcgtcgagtc caacgatgat gcgccggcgc acacgcacaa aaggtgcaaa       240
     atgtgcggca acgtgtgcca cgcgcggatg aactcgtgca gctcgtgctg cctccctttc       300
     gtcgatcgcg ggtcgtggga gccggcgacg atgccgaggc ccggcggaga cgtccactcg       360
     gagaccgact ccgactccga ctccgactcc gactccgacg acgagaccga ggtcgaccat       420
     gtcaccgaac ccaccgcacc cgcggtcaac gccgcctccg cgatggagcg aaggcgccgc       480
     gagcgccgcg cggccgccgc cgtcccctcg ggcggaccgg tcggcggacc agtcgcgtcg       540
     gactccgccg acgccacgac gcgacccggg tggcacgact ggttcaaccg aaccggtcgc       600
     ctccgcgaag ccccgacgca cgaacgcggc ctcgacccaa cgctggagcg ctcgtacgcg       660
     gcgctgggct gcgcgttcgg ggcgaccgag gcggatgttc ggatcgcgta ccgaaagtgc       720
     gttcgccgcg ttcacccaga ctcgggcgga tcgcgcaagc aactcgcgag ggtccacgac       780
     gcgctcgagg cgatcgatcg cgacgcgtgg tcgcacggag agggcgccgc ggcgctgcgc       840
     gaggcgttgg ttgcgtccga gagcgagccg gtttctacgg agacgggggc gaagaagccg       900
     agggtcttcg tgtcgctggc cgtgtaccga gaccccgagg ggctgcacac tctgaaggac       960
     gcgttcgatc gcgcgagcga cccctcgcgg atcttcgcgg gagtgcactg gcagcacgtt      1020
     ctcgccaaac cctcgggcga ggagcccgtg gtggataggc ttcaccccgc gcagaacatg      1080
     ttcactcggc aggtcgaggc caacctcgga aagattcagg gcgacgagga caaggtgcgg      1140
     tacctggagg agagcatgaa gcagcagggc gataatcagc gcgacctcga cgagaaggag      1200
     gcgcggttgc acgcaaaggc cagcctcgac gccaccgacg gtacgaagtg ggagtgggcg      1260
     ggtcacgtcc gcgagacgag ggagtcgtgg gagtgcgccg agggtccgtg cagggcccgg      1320
     cacatgtcca tgcggctgtg gggcggcgag gagtacgtgc tgcacgctga ctcgagaacc      1380
     aggttcgacc acggctggga cgacgttctc atcgccgagc tcgagcgaat ccagacactg      1440
     acgaacaacc ccgccgtctt gaccggcgtg cccctcgggt accacatgcg catgaccccg      1500
     gttgacaacc ccgaaacgta cgagcgcgtc ggttacttac ccgtgtatgg tagggacgag      1560
     gaacgggaac acgagctgag caacctcgtc gtgccgctgc ggcgcgaccg aacggacgac      1620
     gcaccgtcca tcgcggcgtt gggcgtatgc ggcttcggcg atcttctctg ctacccggcc      1680
     gcggtccgct tggcgccgta cgacgccgcc gacgccgacg agccgccgct acccgcgatg      1740
     ctggtcaacc cttcgtttgt gtttgcgcca gcgaaggcgc tcgtcgcgga cgctcccccg      1800
     gacctccacg cgcccttcct gtacctcggc gaggagctca taacctccgc gaggctgtgg      1860
     accaaggggt ggaggaccta cctgccgcgg cactgtccct tgcgggtgtg ttacgatccg      1920
     aggaatcgaa tcgacgagac gcgcgaggac aagaggcgcg gcgcgcaact ctacgatcat      1980
     cccaggtctg aagcggcgag gggtacgtgg gaccagctcg aggagcggta cttcatgaac      2040
     ctgcagtcgc gaaggcgcgt gctgcaggtc atcggcgcgc ccgatccgga ctcggcgacg      2100
     cgcgatccgc gggacgccgt gatcctgaag gagccgtggg cgcccggttc cgttcgtccg      2160
     gtgagcgaat tcgtaaagtc gctgggcgtg gactttgacg agcgcgaaat ctcgaacacg      2220
     tcgcggtatg ccgggctgga ccgcgacgcg ttgaacatga cccacgacac gcgcgccgtc      2280
     aagaagaggg acaccttcgc cgcgcggacg gacgcgacgg agctgggcga cgacgtactc      2340
     gccgacgacg ggttgccctt gaaatggaaa aatggcagcc ccttgttcgg ggacctcagc      2400
     gcgggatact acgaacgcac ggaacgatgg agctaa                                2436
//

If you have problems or comments...

PBIL Back to PBIL home page