(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE46

MICSR_1.PE46         Location/Qualifiers
FT   CDS_pept        89706..91805
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636051"
FT                   /orf_name="MICPUN_52109"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO61606.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199ABA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S3"
FT                   /transl_table=1
FT                   /translation="MGPKKGGTKKAAQTAKTAKAAGKKPPGRPRKVKEPVQEEEPAEDA
FT                   PADDDQADDEKGSGRSEPADDATPMDDADPVEAKATDDDAPAAKEDPPAADGEADDKTK
FT                   AGGDEPHPTIGTVPDETVRSCLRIVVPSDKAGYVIGPRGKIVAHARKESGCGFHLQETS
FT                   KTHAARVAVVTCADKRSEPGSFQGVRGVEMVYLRSTEEMIPKDADLNDPPMGARPEQTQ
FT                   TQRVHIIVAASQMEKADVSELATGAGADCEKVVALEKGSKDCEALHAALGSIVFPTDRF
FT                   VEIVGTDAAVRAALTVLMMRLDYRANPPIASEDPLLLIDAPDVKEGYFREKKEKDRLQR
FT                   ARDSHGAGRDGRGRHHPYGGGGRGGGGGGNYDRGPPPRGSGGGGGGDEIRMTFGIDAQF
FT                   AGGVIGKMGSNVGQIRRESGARITVHESHGKFRVVAIEGTDRQCHDAKHLVQQAVTKQG
FT                   GGPVGAHRIEPSTGRGGRDGRGRDTAVHRDPVVRGGAAGGGSYYDQYDRRGRGDRGYDR
FT                   GGYDRGGYDRGGYDRGGYDRGGYDRGGGYGRDAYYDAQGPGSAYADRSSYPDRGGYGGG
FT                   GRDAPHYDERDTHRQWLGGDRDGGYNNYQGVQQSHQQQQGWAGQNQQWGGSNQQQSYNN
FT                   QQPSYHGQQQSYDQGGGYNNNQQGGGNDYYNRGQQQSGYGNQGGQYDQQGDYYSRGQQW
FT                   GGSRY"
     atgggcccaa agaagggagg cacaaagaag gccgcgcaga ccgcgaagac cgcgaaggcg        60
     gcggggaaga aaccgccggg ccgtcccagg aaggtcaagg agcccgtcca ggaggaggaa       120
     cccgccgagg acgctcccgc tgacgatgat caagctgacg acgagaaggg ctcgggccga       180
     tccgagcccg ccgacgacgc gaccccgatg gacgacgccg atccggtcga ggcgaaagcg       240
     accgacgacg acgcccccgc ggcgaaggag gatcctcccg cggcggacgg cgaggcggac       300
     gacaaaacga aggcgggagg cgacgagccg caccccacga tcggcacggt tcccgacgag       360
     acggttcgct cgtgcctccg catcgtcgtc ccgagcgaca aggcgggcta cgtcatcggc       420
     ccgcgcggca agatcgtcgc gcacgcgcgc aaggaatccg ggtgcgggtt tcacctgcag       480
     gagacgtcca agacacacgc cgcgcgcgtc gcggtggtga cgtgcgccga caagcgatcc       540
     gaacccggat ccttccaggg cgttcgcggc gtcgagatgg tctacctgcg atccacggag       600
     gagatgatcc cgaaagacgc cgaccttaac gatcccccga tgggcgcgag accggagcag       660
     acgcagaccc aacgcgtaca catcatcgtc gcggcgtcgc agatggaaaa ggcggacgtg       720
     tccgaactcg cgacgggcgc gggcgccgac tgcgagaagg tcgtcgcgtt ggaaaagggt       780
     tccaaagatt gcgaggcgct tcacgcggcg ttgggttcca tcgtctttcc caccgatcgg       840
     ttcgtcgaga ttgtcgggac ggacgcggcg gtgcgggcgg cgctgacggt gctgatgatg       900
     cgcctcgact accgcgctaa ccccccgatc gcctctgagg atcccctgct cctcatcgac       960
     gcccccgacg tgaaggaggg atactttagg gagaagaagg agaaggaccg gctgcaacgc      1020
     gctcgcgatt cccacggcgc gggacgcgac ggccgaggcc gccaccaccc ttacggcggc      1080
     ggcgggcgtg gaggcggcgg cggcggcaac tacgacaggg gtcccccgcc ccgcggcagc      1140
     ggcggcggcg gcggcggcga cgagattcgc atgacgtttg gcatcgacgc gcagttcgcc      1200
     ggcggcgtca tcggcaagat gggctccaac gtgggccaga tccgtcgcga gtccggcgcg      1260
     aggatcaccg tccacgagtc ccacggcaag ttccgcgtgg tggccatcga gggaaccgac      1320
     cgccagtgcc acgacgccaa gcacctcgtg cagcaggcgg tgaccaagca gggcggaggc      1380
     cccgtgggcg cgcacaggat cgagccatcc accggccggg gcggtcgaga cggccgggga      1440
     cgcgacacag ctgtacatcg cgaccccgtc gtacgcggcg gcgcagccgg cggcgggagc      1500
     tactacgacc agtacgatcg acgcggccgc ggggatcggg gatacgatcg cgggggatac      1560
     gatcgcgggg gatacgatcg cgggggatac gatcgcgggg gatacgatcg cgggggatac      1620
     gatcgcggcg gcgggtacgg tcgagacgct tactacgacg cccaggggcc ggggtcggcg      1680
     tatgcggaca ggtcctccta ccccgaccgc ggcgggtacg gcggcggcgg gagggacgcc      1740
     cctcactacg acgagcgcga cacgcaccgg cagtggctcg gcggtgaccg cgacggcggc      1800
     tacaacaact accagggcgt gcagcagtcc caccagcagc agcagggttg ggccggccag      1860
     aaccagcagt ggggcggctc caaccagcag cagtcctaca acaatcagca gccctcctat      1920
     cacggtcagc agcagtccta cgaccagggg ggcggataca acaacaatca gcagggcggc      1980
     ggcaatgact actacaaccg cggtcagcag cagtcaggct acggcaacca ggggggtcag      2040
     tacgaccagc agggcgacta ttacagccgg ggccagcagt ggggcgggtc cagatactaa      2100
//

If you have problems or comments...

PBIL Back to PBIL home page